DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and EFNB3

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001397.1 Gene:EFNB3 / 1949 HGNCID:3228 Length:340 Species:Homo sapiens


Alignment Length:384 Identity:88/384 - (22%)
Similarity:138/384 - (35%) Gaps:110/384 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICP-VYEPGTFENET-EKYIIYNVSKVEYE 281
            ::||::|..|:.:. .:::....|      |::.::|| ...||...:.. |.|.:|.|...:..
Human    33 VYWNSANKRFQAEG-GYVLYPQIG------DRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGR 90

  Fly   282 TCRITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTS--SKDDLYRRIGG 344
            .|....| |.::..||:|...:.|||.|:.::|...|.||...:|||.|:||  :::.|....||
Human    91 RCEAPPA-PNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGG 154

  Fly   345 RCSTNNMKVVFKVCCAPEDNN-KTTALSNSKSVTDTGGAINVNIANNDESHVNSHGNNIAIGTNI 408
            .|.|..|||:.:|..:|.... ....:|......|.|.|.::     :....|..|:..:..|:.
Human   155 VCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSL-----EPGKENLPGDPTSNATSR 214

  Fly   409 GINGGQIIGGPQSAGIPINPLSGNNNINGIPTTINSNIDQFNRIPIQPNIIGNHVGTNAVGTGIV 473
            |..|            |:.|                        |..|.:.|...|...:..|:.
Human   215 GAEG------------PLPP------------------------PSMPAVAGAAGGLALLLLGVA 243

  Fly   474 GGGGIIL--------------TPGHAHGNINMLQPGRGGING---AYPGHHHIQTGIRINNVPTQ 521
            |.||.:.              .|| :.|....|..|.||..|   |.||    :.||.:..    
Human   244 GAGGAMCWRRRRAKPSESRHPGPG-SFGRGGSLGLGGGGGMGPREAEPG----ELGIALRG---- 299

  Fly   522 HNYPSHKGNANSNINGNDDH---HHYNK------HPNEVVKNEELTYNSGAATSDGNIF 571
                          .|..|.   .||.|      ||..:|::       |...|..||:
Human   300 --------------GGAADPPFCPHYEKVSGDYGHPVYIVQD-------GPPQSPPNIY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 42/142 (30%)
PigN <557..>622 CDD:282796 4/15 (27%)
EFNB3NP_001397.1 Cupredoxin 31..168 CDD:327505 42/142 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..225 13/97 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..298 13/48 (27%)
PDZ-binding. /evidence=ECO:0000255 338..340 88/384 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153155
Domainoid 1 1.000 74 1.000 Domainoid score I9142
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm40642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.