Sequence 1: | NP_651927.1 | Gene: | Ephrin / 43799 | FlyBaseID: | FBgn0040324 | Length: | 652 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016875895.1 | Gene: | EFNB2 / 1948 | HGNCID: | 3227 | Length: | 335 | Species: | Homo sapiens |
Alignment Length: | 230 | Identity: | 68/230 - (29%) |
---|---|---|---|
Similarity: | 100/230 - (43%) | Gaps: | 47/230 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 DQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFT 313
Fly 314 PQPGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV----CCAPEDNNK------ 366
Fly 367 -TTALSNSKSVTDTGGAINVNIANNDESHVNSHGNNIAIGTNI----GINGGQII---------- 416
Fly 417 -----------GGPQ-SAGIPINPL-----SGNNN 434 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ephrin | NP_651927.1 | Ephrin_ectodomain | 217..358 | CDD:259861 | 43/114 (38%) |
PigN | <557..>622 | CDD:282796 | |||
EFNB2 | XP_016875895.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165153156 | |
Domainoid | 1 | 1.000 | 74 | 1.000 | Domainoid score | I9142 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001210 | |
OrthoInspector | 1 | 1.000 | - | - | otm40642 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11304 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4391 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.970 |