DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and EFNB2

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_016875895.1 Gene:EFNB2 / 1948 HGNCID:3227 Length:335 Species:Homo sapiens


Alignment Length:230 Identity:68/230 - (29%)
Similarity:100/230 - (43%) Gaps:47/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 DQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFT 313
            |::.||||..:..|. .:.|.|.:|.|.|.:.:.|.|...:..::. |.||.:.:.|||.|:.|:
Human    58 DKLDIICPKVDSKTV-GQYEYYKVYMVDKDQADRCTIKKENTPLLN-CAKPDQDIKFTIKFQEFS 120

  Fly   314 PQPGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV----CCAPEDNNK------ 366
            |...||||....|||.||||  |.:.|..:.||.|.|..||::.||    ..|....||      
Human   121 PNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRP 185

  Fly   367 -TTALSNSKSVTDTGGAINVNIANNDESHVNSHGNNIAIGTNI----GINGGQII---------- 416
             ..|.:|.:|.| |...:..|..::.:.:...|..|..:|:.:    ||..|.||          
Human   186 ELEAGTNGRSST-TSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVV 249

  Fly   417 -----------GGPQ-SAGIPINPL-----SGNNN 434
                       ..|| :..:.::.|     |||||
Human   250 LLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 43/114 (38%)
PigN <557..>622 CDD:282796
EFNB2XP_016875895.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153156
Domainoid 1 1.000 74 1.000 Domainoid score I9142
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm40642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.