DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and EFNA4

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_872631.1 Gene:EFNA4 / 1945 HGNCID:3224 Length:207 Species:Homo sapiens


Alignment Length:181 Identity:52/181 - (28%)
Similarity:79/181 - (43%) Gaps:37/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYE-PGTFENETEKYIIYNVSKVEYET 282
            ::||:||.  |:...|.::::...      |.:.|:||.|| ||..|. .|.:.:|.|....||:
Human    30 VYWNSSNP--RLLRGDAVVELGLN------DYLDIVCPHYEGPGPPEG-PETFALYMVDWPGYES 85

  Fly   283 CRITNADPRVIA--ICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGGR 345
            |:...  ||...  :|..|...:.|:...:.|||...|.|||||..||:||..:.:.     .|:
Human    86 CQAEG--PRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES-----SGQ 143

  Fly   346 CSTNNMKVVFKVCCAPEDNNKTTALSNSKS-----VTDTGGAINVNIANND 391
            |    :::...|||   ...:...|..|..     ...|||      ||:|
Human   144 C----LRLQVSVCC---KERRARVLPRSPGGGGIPAACTGG------ANSD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 41/141 (29%)
PigN <557..>622 CDD:282796
EFNA4NP_872631.1 Ephrin-A_Ectodomain 27..152 CDD:259896 41/141 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.