DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efn-3

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_510250.3 Gene:efn-3 / 184508 WormBaseID:WBGene00001164 Length:211 Species:Caenorhabditis elegans


Alignment Length:240 Identity:58/240 - (24%)
Similarity:93/240 - (38%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEK 269
            :.::.:.||.....:.||:.........|...:|:.        ||:.||||.....|:|...  
 Worm    11 LFVAPLVSCRNYHDVMWNSKQFPVAFKTTPIKVDLG--------DQLTIICPKAYGMTYEYAK-- 65

  Fly   270 YIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSS 334
              :|.|.:.|:..|.:  .:|..:.:|..........:.||...|.|.|::|..|..||.||||:
 Worm    66 --LYWVGETEWSQCWL--HEPVWLGVCATENYTTEVKLIFRQTNPIPDGMDFQVGKTYYIISTST 126

  Fly   335 KD--DLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKS-VTDTGGAINVNIANNDESHVN 396
            .|  .:.:.:||.|..::||:...|....:.       |:||| :|:...|              
 Worm   127 GDIEGINQAVGGLCKYHHMKLAISVVGYEKQ-------SHSKSEITEKNFA-------------- 170

  Fly   397 SHGNNIAIGTNIGINGGQIIGGPQSAGIPINPLSGNNNINGIPTT 441
             ||    ||..|. ..||::.            ||:.|...:.||
 Worm   171 -HG----IGYEIH-EVGQLVS------------SGHQNFTLLTTT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 37/142 (26%)
PigN <557..>622 CDD:282796
efn-3NP_510250.3 Ephrin_ectodomain 22..151 CDD:259861 37/142 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm14114
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.