DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and Efna3

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_574979.4 Gene:Efna3 / 170901 RGDID:620390 Length:230 Species:Rattus norvegicus


Alignment Length:218 Identity:53/218 - (24%)
Similarity:85/218 - (38%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LLTLICMETVLLSTMS-----SCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIIC 255
            ||.|:.:...||..::     :......::||:||...|.:.....::||        |.:.|.|
  Rat     7 LLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVN--------DYLDIYC 63

  Fly   256 PVYEPGTFENETEKYIIYNVSKVEYETCRITNADPR-----------VIAICDKPQKLMFFTITF 309
            |.|.........|:|::|.|:...|.||..:....|           .|...:|.|:...|::  
  Rat    64 PHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSL-- 126

  Fly   310 RPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSK 374
                    |.||..|.:||:|||.:     ..:..:|.  .|||.  ||||      :|:.|..|
  Rat   127 --------GYEFHAGQEYYYISTPT-----HNLHWKCL--RMKVF--VCCA------STSHSGEK 168

  Fly   375 SVT-----DTGGAINVNIANNDE 392
            .|.     ..|..:.:|:..:.|
  Rat   169 PVPTLPQFTMGPNVKINVLEDFE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 37/151 (25%)
PigN <557..>622 CDD:282796
Efna3XP_574979.4 Ephrin-A_Ectodomain 31..158 CDD:259896 37/153 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.