DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and Efna1

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_034237.3 Gene:Efna1 / 13636 MGIID:103236 Length:205 Species:Mus musculus


Alignment Length:208 Identity:54/208 - (25%)
Similarity:84/208 - (40%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEP 260
            ||.|.|        ..:.|....:.||:||..||.::....:.:|        |.:.||||.||.
Mouse     8 LLGLCC--------SLAAADRHIVFWNSSNPKFREEDYTVHVQLN--------DYLDIICPHYED 56

  Fly   261 GTFENET-EKYIIYNVSKVEYETCRITNADPRVIAICDK------PQKLMFFTITFRPFTPQPGG 318
            .:..:.. |:|.:|.|...||..|:..:.| :|...|::      |:||   :..|:.|||...|
Mouse    57 DSVADAAMERYTLYMVEHQEYVACQPQSKD-QVRWNCNRPSAKHGPEKL---SEKFQRFTPFILG 117

  Fly   319 LEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGGAI 383
            .||..|:.||:||    ..:|.: ..:|.  .:||                            .:
Mouse   118 KEFKEGHSYYYIS----KPIYHQ-ESQCL--KLKV----------------------------TV 147

  Fly   384 NVNIANNDESHVN 396
            |..|.:|.::|||
Mouse   148 NGKITHNPQAHVN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 43/147 (29%)
PigN <557..>622 CDD:282796
Efna1NP_034237.3 Ephrin-A_Ectodomain 19..147 CDD:259896 43/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.