DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efna3b

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_571929.1 Gene:efna3b / 117506 ZFINID:ZDB-GENE-011108-1 Length:219 Species:Danio rerio


Alignment Length:202 Identity:52/202 - (25%)
Similarity:87/202 - (43%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEP 260
            ||||.|....|::     |....:|||:||.:.|.:.....::||        |.:.|.||.|. 
Zfish    10 LLTLTCTNFALVT-----AARHAVHWNSSNILLRKEGYTLQVNVN--------DYLDIYCPHYN- 60

  Fly   261 GTFENETEKYIIYNVSKVEYETCRITNADPRV---IAICDK---PQKLMFFTITFRPFTPQPGGL 319
            .:.....|:|::|.||...|.||     ||::   ...|::   |...:.|:..|:.::....|.
Zfish    61 SSQRGIAEQYVLYMVSYRGYRTC-----DPQLGFKRWECNRPHAPHAPIKFSEKFQRYSAFSLGY 120

  Fly   320 EFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGGAIN 384
            ||..|.:||:|||.:     ...|..|    :::...|||:...::     .:....|:....:.
Zfish   121 EFHVGQEYYYISTPT-----HHHGRSC----LRLRVYVCCSTASDS-----DDEPQPTEPDYTLR 171

  Fly   385 VNIANND 391
            .||..:|
Zfish   172 PNIKIDD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 38/146 (26%)
PigN <557..>622 CDD:282796
efna3bNP_571929.1 Ephrin-A_Ectodomain 25..150 CDD:259896 38/147 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.