DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efnb3

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001106481.1 Gene:efnb3 / 100127666 XenbaseID:XB-GENE-5902269 Length:331 Species:Xenopus tropicalis


Alignment Length:319 Identity:89/319 - (27%)
Similarity:133/319 - (41%) Gaps:69/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 MIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAF 246
            |.|....||.....||.|  .:..:||.:|...    ::||::|..|. |...:::....|    
 Frog     1 MFPREPPGALYVRVLLAL--WDLGILSALSLDP----IYWNSANQRFE-DAEGYVLYPQIG---- 54

  Fly   247 EFDQVHIICPVYEP-GTFENET-EKYIIYNV-SKVEYETCRITNADPRVIAICDKPQKLMFFTIT 308
              |::.::||..|| |.|.:.: |.|.:|.| :|.|..:|.|... |.::..||:|.:.:.|||.
 Frog    55 --DRLDLLCPRSEPRGPFSSSSYEFYKLYLVGTKEEMLSCSILRT-PNLLLTCDRPSQDLRFTIK 116

  Fly   309 FRPFTPQPGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALS 371
            |:.|:|...|.||....|||.|:||  ::|.|....||.|.|..|||..||...|  |.......
 Frog   117 FQEFSPNLWGHEFQSQRDYYIIATSDGTQDGLENLRGGVCETKGMKVTLKVGQNP--NGAPPPRR 179

  Fly   372 NSKSVTDTGGAINVNIANNDESH--VNSHGNNIAIGTN-----------IGINGGQ--------I 415
            .|.:..|:|  |:.::.|.|..:  ..:.||....|.|           .|..||.        :
 Frog   180 PSSAGKDSG--ISPSVPNPDIPNFGAETSGNATKTGENGPLPISHVPLVAGAAGGAALLLLVFGV 242

  Fly   416 IG----------------GPQSAGIPINPLSGNNNING-IPTTINSNIDQFNRIPIQPN 457
            :|                .|.|.|...:|..|..|.|| .|:.|        .:|::|:
 Frog   243 VGWICHRRRQAKHSDTRHPPLSLGSITSPKRGGGNNNGHEPSDI--------IMPLRPS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 50/145 (34%)
PigN <557..>622 CDD:282796
efnb3NP_001106481.1 Cupredoxin 28..168 CDD:327505 51/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9055
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm47820
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.