DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and efnb2

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001093709.1 Gene:efnb2 / 100101723 XenbaseID:XB-GENE-488606 Length:329 Species:Xenopus tropicalis


Alignment Length:282 Identity:82/282 - (29%)
Similarity:122/282 - (43%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ICMETVLLSTMSSCAKTF-YMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTF 263
            :|:  :||.|..|.:... .::||:||:.| :.....|:....|      |::.||||..:..: 
 Frog    15 VCI--LLLRTAISWSTVLDPIYWNSSNARF-LPGQGLILYPKIG------DKLDIICPKVDSKS- 69

  Fly   264 ENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYY 328
            .::.|.|.||.|.|.:.::|.|.:..|  :..|.||.:.:.|||.|:.|:|...||||....|||
 Frog    70 TSQYEYYKIYLVDKEQADSCSIKDKTP--LLNCAKPDQDVKFTIKFQEFSPNLWGLEFQRDKDYY 132

  Fly   329 FISTS--SKDDLYRRIGGRCSTNNMKVVFKVCCAPE-------------DNNKTTALSNSKSVTD 378
            .||||  |.:.:..:.||.|.|..||::.||...|:             |....|   |.||.| 
 Frog   133 IISTSNGSLEGVDNQEGGVCVTKAMKILMKVGQDPDFHIHQGSSSTRRPDQESGT---NGKSST- 193

  Fly   379 TGGAINVNIANNDESHVNSH----GNNIAIGTNIGINGGQII---------------------GG 418
            |...:|.....:.|.|...|    |:.:|:..  ||..|.||                     ..
 Frog   194 TSPHVNGPKGPSTEGHNAGHSSILGSEVALFA--GIASGCIIFIVIIITLVVLLLKYRRRHRKHS 256

  Fly   419 PQ-SAGIPINPL-----SGNNN 434
            || :..:.::.|     |||||
 Frog   257 PQHTTTLSLSTLATPKRSGNNN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 49/143 (34%)
PigN <557..>622 CDD:282796
efnb2NP_001093709.1 Ephrin-B_Ectodomain 29..164 CDD:259897 49/144 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9055
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm47820
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.