DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ephrin and si:dkey-246i14.3

DIOPT Version :9

Sequence 1:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_001343018.4 Gene:si:dkey-246i14.3 / 100003450 ZFINID:ZDB-GENE-100922-64 Length:202 Species:Danio rerio


Alignment Length:218 Identity:62/218 - (28%)
Similarity:94/218 - (43%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 RCKMMIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTSNSIFRIDNTDHIIDVNKG 242
            ||.        |..:.:.||.|      .:..:|:.||...::||::|:  |:...|:.:.||..
Zfish     5 RCS--------GVCAMMRLLAL------FIHVLSTTAKRHVVYWNSTNT--RLTGDDYSVQVNLS 53

  Fly   243 NLAFEFDQVHIICPVYEPGTFEN--ETEKYIIYNVSKVEYETCRITNADPRVIAI----CDKPQK 301
                  |.:.|:||.| ||...:  ..|...:|.|::.::..|..|..     ||    |::|  
Zfish    54 ------DYLDILCPHY-PGDHPSGASVETLALYLVAESQFRGCVDTKE-----AIKRWECNQP-- 104

  Fly   302 LMF-------FTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG---RCSTNNMKVVFK 356
              |       |:...:.|||...|.|||||:.||:.|.|:.|       |   .|    ||:...
Zfish   105 --FAPFGPVRFSEKIQRFTPFSLGFEFLPGHHYYYSSLSTDD-------GPPLPC----MKLRVT 156

  Fly   357 VCCAPEDNNKTTALSNSKSVTDT 379
            |||.|     |||.|:.:..|:|
Zfish   157 VCCPP-----TTAGSSRQEATET 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 43/156 (28%)
PigN <557..>622 CDD:282796
si:dkey-246i14.3XP_001343018.4 Ephrin-A_Ectodomain 28..158 CDD:259896 44/158 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.