DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34106 and CG34169

DIOPT Version :9

Sequence 1:NP_001036365.1 Gene:CG34106 / 4379891 FlyBaseID:FBgn0083942 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001097170.1 Gene:CG34169 / 5740400 FlyBaseID:FBgn0085198 Length:124 Species:Drosophila melanogaster


Alignment Length:117 Identity:58/117 - (49%)
Similarity:76/117 - (64%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YDQVIFTAELLHHRTVGSQIEETRRHWEERCSWFPAAQRNMASRCSEIYKESLEKYGNDYYEFYA 66
            |.:|||..:|.|.|.|.|||::||..||:..:||..|||...||.:.||.||.|.||:..|.:||
  Fly     4 YSEVIFVDQLKHFRVVASQIDKTRITWEKNSAWFADAQRENYSRYASIYAESRETYGDKMYGYYA 68

  Fly    67 NRNRLKEEHRVNTKSYKRRERRRSHRPMDHLKDYRVSPTSNGEYGSVRPMLL 118
            .||||:.|:.|.:::..|:|.|..:..|.|||||:.|.|:|||||.|||..|
  Fly    69 RRNRLRSEYSVKSEAATRQEIRYENESMAHLKDYKYSETTNGEYGRVRPSAL 120



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016627
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.