DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34134 and PHKA1

DIOPT Version :10

Sequence 1:NP_001036347.1 Gene:CG34134 / 4379889 FlyBaseID:FBgn0083970 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001417997.1 Gene:PHKA1 / 5255 HGNCID:8925 Length:1240 Species:Homo sapiens


Alignment Length:123 Identity:26/123 - (21%)
Similarity:43/123 - (34%) Gaps:44/123 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAPEW---MSNEMARLTSRL--ERYKPTG-----------SGYNRIQSIRLSKSVTQMLNNP-- 47
            |:.|:|   :.||.:.....|  |.|...|           ||..|.:...|.::.|.:|::.  
Human   789 MKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEALDEACTDLLSHQKH 853

  Fly    48 ----MPPAPAAATARSQPESSFTTPRRRGVLSRTQSEWEEVYPVVKFNRQGSSESDIS 101
                :||.|.        |.:.:.|.....|::...|              :||.|:|
Human   854 LTVGLPPEPR--------EKTISAPLPYEALTQLIDE--------------ASEGDMS 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34134NP_001036347.1 None
PHKA1NP_001417997.1 Glyco_hydro_15 8..>439 CDD:395586
Bac_rhamnosid6H <804..922 CDD:481215 21/108 (19%)
Calmodulin-binding. /evidence=ECO:0000255 810..840 6/29 (21%)
Calmodulin-binding. /evidence=ECO:0000255 1063..1103
KPBB_C <1077..>1151 CDD:437124
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.