DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34134 and Phka2

DIOPT Version :10

Sequence 1:NP_001036347.1 Gene:CG34134 / 4379889 FlyBaseID:FBgn0083970 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_006528742.1 Gene:Phka2 / 110094 MGIID:97577 Length:1240 Species:Mus musculus


Alignment Length:55 Identity:15/55 - (27%)
Similarity:24/55 - (43%) Gaps:11/55 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EMARLTSRLERYKPTGSGY-NRIQSIRLSKSVTQMLNNPMPPAPAAATARSQPES 63
            :|.|..|..|::.|.|... |.:.||:..:|.|          |::.|..|..:|
Mouse  1014 QMNRRASADEQFFPLGQTMSNSLHSIKSVRSST----------PSSPTGTSSTDS 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34134NP_001036347.1 None
Phka2XP_006528742.1 Glyco_hydro_15 13..>444 CDD:395586
Bac_rhamnosid6H <807..924 CDD:481215
KPBB_C 935..>1152 CDD:437124 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.