DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BG642163 and AT1G79480

DIOPT Version :9

Sequence 1:NP_001036331.1 Gene:BG642163 / 4379888 FlyBaseID:FBgn0083938 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_178066.2 Gene:AT1G79480 / 844286 AraportID:AT1G79480 Length:397 Species:Arabidopsis thaliana


Alignment Length:343 Identity:102/343 - (29%)
Similarity:140/343 - (40%) Gaps:100/343 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PFVQL--LTLP--APPSLIPPASPIPSHQYPGLFAPPSFAQFPGLLGSTGSGPSGIPNLPGTNAS 170
            |:|.|  |::|  |||..|.|.:..||..||||..||              ||..:||.|.::::
plant    89 PYVSLPPLSVPGNAPPFCINPPNTPPSSSYPGLSPPP--------------GPITLPNPPDSSSN 139

  Fly   171 PGWSSPGSSIPSYQLPGIQQQPGSSPVEYPHAPIKPPSSAPAGWSSPGS-PIPPPSLPGLPGTPD 234
            |. |:|                  :|.|....|..|.||     |:|.| |.||.::|       
plant   140 PN-SNP------------------NPPESSSNPNPPDSS-----SNPNSNPNPPVTVP------- 173

  Fly   235 QNPWGSADRPAHPPASPIQPGW--SPPGSSFPPSPQSGPPGPP----NWNQLESANRPVYPPEMP 293
             ||..|:..| :||.|...|..  :||.||..|:|....|.||    |.|..||::.|..|..:|
plant   174 -NPPESSSNP-NPPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNPPESSSNPNPPITIP 236

  Fly   294 IPPVWNSRRSSNPSAQLPPLQEA---PLGSLGPSQLPPGLPAPPSWSSLESSN----PLVQRPEL 351
            .||   ...|.||...:|...|:   |...|||....|| |:.|:.|....|:    |:|..|.:
plant   237 YPP---ESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPG-PSTPTGSIPSPSSGFLPPIVYPPPM 297

  Fly   352 MAP-PSLSPSGSSNSVLQPLPAKP------NWR-SSGSPNSPLYPPGLPAPPSESIPDISPN--- 405
            ..| ||::|:.:...|.:|....|      |:. .||:....:.|.|         |...||   
plant   298 APPSPSVTPTSAYWCVAKPSVPDPIIQEAMNFACGSGADCHSIQPNG---------PCFKPNTLW 353

  Fly   406 -----------QKTRSAG 412
                       |:|:|.|
plant   354 AHASFAYNSYWQRTKSTG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BG642163NP_001036331.1 PHA03247 <118..415 CDD:223021 98/333 (29%)
AT1G79480NP_178066.2 PRK14971 <222..>290 CDD:237874 22/71 (31%)
X8 311..394 CDD:197867 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.