DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BG642163 and col-41

DIOPT Version :9

Sequence 1:NP_001036331.1 Gene:BG642163 / 4379888 FlyBaseID:FBgn0083938 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_510522.1 Gene:col-41 / 181610 WormBaseID:WBGene00000618 Length:428 Species:Caenorhabditis elegans


Alignment Length:315 Identity:95/315 - (30%)
Similarity:126/315 - (40%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SHQYPG--LFAPPSFAQFPGLLGSTGSGPSGIPNLPGTNASPGW-SSPGSSIPSYQLPGIQQQPG 193
            :|..||  :..|...|..||..|.  |||.|.|.|.|.:...|. .:||..    ..||.|.:.|
 Worm   129 THDIPGGCIKCPEGPAGPPGPDGD--SGPEGFPGLQGQSGPSGEDGAPGQE----GAPGDQGEQG 187

  Fly   194 SSPVEYPHAPIKPPSSA--PAGWSSPGSP--IPPPSLPGLPGTPDQNPWGSADRPAHPPASPIQP 254
            ....:....|...|.:.  |.....||.|  :..|.|||..|.|.:      |....|..:|..|
 Worm   188 PKGYDGTDGPDGQPGTTYFPGQAGQPGEPGWLGEPGLPGQHGEPGK------DGEEGPQGAPGTP 246

  Fly   255 GWSPPGSSFPPSP-QSGPPGPP----NWNQLESANRPVYPP----EMPIPPVWNSRRSSNPSAQL 310
            | :....:||.:| |:|.||.|    |:...........||    ..|.||...|  ::.|..:.
 Worm   247 G-NAGHDAFPGTPGQAGKPGAPGKDANYCPCPQRQDDRTPPSSGTSAPQPPPRGS--TAAPGTRA 308

  Fly   311 PPLQEAPLGSLGP---SQLPPGL--PAPPSWSSLESSNPLVQRPELMAPPSLSPSGSSNSVLQPL 370
            ||...||..:..|   ::.||..  |||       :|.|.|:.||  .|.|..||.:......|.
 Worm   309 PPATRAPPATRAPPATTRAPPATTRPAP-------ASQPPVREPE--TPDSGYPSPAPQEPAHPS 364

  Fly   371 PA--KPNWRSSGSPN----SPLYP-PGLPAPPSESI-PDISPNQKT--RSAGSPP 415
            |:  .|::.|...|:    ||.|| |..||.|:.|: |...|.|.:  ..|.|||
 Worm   365 PSYPSPSYPSPSYPSPSYPSPSYPSPSYPAEPAYSVPPPAKPEQPSGGYDAPSPP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BG642163NP_001036331.1 PHA03247 <118..415 CDD:223021 93/313 (30%)
col-41NP_510522.1 Col_cuticle_N 3..55 CDD:198156
PRK07764 <153..362 CDD:236090 66/230 (29%)
Collagen 208..267 CDD:189968 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28921
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.