DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34124 and CG10064

DIOPT Version :9

Sequence 1:NP_001036333.1 Gene:CG34124 / 4379887 FlyBaseID:FBgn0083960 Length:2003 Species:Drosophila melanogaster
Sequence 2:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster


Alignment Length:536 Identity:108/536 - (20%)
Similarity:171/536 - (31%) Gaps:189/536 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 TVGENGARPTVFIYEYPSLNVRVKLLNAAQNCFTAGSYNKTGELFASQAGYPDFIITIWRWENAE 162
            |.|:...|....:.|...|.|:..|:.:....|.....|||.|......|..|.:         :
  Fly   173 TAGDRHLRLWSILREEKKLYVQDVLMASKTRVFYCARINKTDEFAYLGTGTGDIV---------K 228

  Fly   163 VVLR-------AKSFQSDILFVHFSEHNP------------------------ILLCSSGLSHIK 196
            :||.       :|...:..:...|..|||                        .||..:|...|:
  Fly   229 IVLNCCDRDHVSKQGSTSCILGAFGTHNPRKPTGRDCNRYVNGVRALYVLEGGRLLIGAGNGDIE 293

  Fly   197 F-------------------WKMANTFTGLKLKGDLGRF--GKTDFSDIYAMYMLQDENVISGSD 240
            .                   |....|.....:.|.:..|  .|||.     .|:..|.|.|.|. 
  Fly   294 LVEERTDVPLINFRDYPGPTWPYLRTLKKTHVSGRISSFVRSKTDM-----FYICTDTNEIYGL- 352

  Fly   241 WGNMLLWQAGLIKFEICRKGRKPCHTKPITRITM-KN--GEVTTVGMDGYVRVWYWETVDLADPP 302
              |:..|...|:         :.||||.:..||. ||  |...|.|.: .:|:|       :...
  Fly   353 --NIKTWVLKLL---------RTCHTKSVYCITFPKNYSGVFATSGKE-CIRIW-------SSGR 398

  Fly   303 EDDLFVEIDPIYEFKIADVELRCMQKIHPFDESDFTHYAQDGNG--GIW-------FCDIN---T 355
            :.:|...:  :|.|..|     |::         |||   ||..  .:|       |..|.   .
  Fly   399 KQELLRIM--VYNFNCA-----CVR---------FTH---DGTSIVSVWNDGIIRAFTPITGRLI 444

  Fly   356 YDVPQKPRKLYSCIGGKVLAAQMSPVSPHFLCMSESGKLFV---------------YQYDEQRLI 405
            |.:|....|..|.                 |.::.||:|.|               |:.|...::
  Fly   445 YAIPNAHNKGCSA-----------------LAVASSGRLIVTGGIEGQVRVWKIDPYRQDLVGVL 492

  Fly   406 LEKEFPAEGVDVIWLDTNISVKGTELVAAFKDGILRQMYLDLSNGERPKMTRVRAFKAHTSPITA 470
            .:...|...:|:.:||       ||:::|..||..  :..|:.     :|||.:...|:|..::|
  Fly   493 KDHSGPITSLDINYLD-------TEVISACTDGSC--VIWDIK-----RMTRKQVVTANTQFMSA 543

  Fly   471 LTVSRNSSLLLTGSADKSIF--------IYQLSRDEHQMVDMRPLGFVQFAAIPNCFYWHETEPT 527
            ........::..||..:.|:        |.:|:..:...|              ||...:||...
  Fly   544 SYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSV--------------NCLAINETGDY 594

  Fly   528 VVLVGCK-SGDLYEYN 542
            .:.||.. ...|::||
  Fly   595 FITVGSDLQVKLWDYN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34124NP_001036333.1 WD40 repeat 90..124 CDD:293791 7/25 (28%)
WD40 repeat 131..166 CDD:293791 7/34 (21%)
WD40 135..493 CDD:295369 89/447 (20%)
WD40 163..574 CDD:225201 94/471 (20%)
WD40 repeat 174..217 CDD:293791 12/87 (14%)
WD40 repeat 270..318 CDD:293791 12/50 (24%)
WD40 repeat 323..370 CDD:293791 13/58 (22%)
WD40 repeat 414..462 CDD:293791 12/47 (26%)
WD40 repeat 468..511 CDD:293791 7/50 (14%)
CG10064NP_648065.1 WD40 <25..188 CDD:295369 3/14 (21%)
WD40 33..434 CDD:225201 64/313 (20%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791 3/12 (25%)
WD40 280..652 CDD:225201 87/420 (21%)
WD40 366..650 CDD:238121 67/317 (21%)
WD40 repeat 370..407 CDD:293791 10/46 (22%)
WD40 repeat 412..449 CDD:293791 11/53 (21%)
WD40 repeat 456..494 CDD:293791 8/54 (15%)
WD40 repeat 499..535 CDD:293791 12/49 (24%)
WD40 repeat 541..576 CDD:293791 5/34 (15%)
WD40 repeat 583..617 CDD:293791 10/42 (24%)
WD40 repeat 625..651 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13720
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.