DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and TIM13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_011697.3 Gene:TIM13 / 853093 SGDID:S000003413 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:30/69 - (43%)
Similarity:48/69 - (69%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLISRVYG 74
            ||.:|:.|::|||||.||:.:::|.||:||:..|..:.:.:   ||..|:.::|.|||:||:.|.
Yeast    32 ELKNQIAQELAVANATELVNKISENCFEKCLTSPYATRNDA---CIDQCLAKYMRSWNVISKAYI 93

  Fly    75 QRIQ 78
            .|||
Yeast    94 SRIQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 24/58 (41%)
TIM13NP_011697.3 zf-Tim10_DDP 35..92 CDD:397210 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346506
Domainoid 1 1.000 63 1.000 Domainoid score I2464
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1701
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59611
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm46773
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.