DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and CG42302

DIOPT Version :10

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster


Alignment Length:70 Identity:31/70 - (44%)
Similarity:49/70 - (70%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLISRVYGQR 76
            :::::|||.:||.|||:.:||.:||..|:..|...|.|:|:.|::.||||||||..::|..|.:|
  Fly     8 LERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSVQVVSSQYFRR 72

  Fly    77 IQREQ 81
            .:|.|
  Fly    73 RRRHQ 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 13..75 CDD:460764 28/61 (46%)
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764 27/57 (47%)

Return to query results.
Submit another query.