DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and timm13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001039237.1 Gene:timm13 / 734099 XenbaseID:XB-GENE-993979 Length:96 Species:Xenopus tropicalis


Alignment Length:78 Identity:54/78 - (69%)
Similarity:68/78 - (87%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLIS 70
            ||.|.:|:|||.|||||||||||.:||:|||:||:.|||.|||:||||||:|||||:||:||.:|
 Frog    18 VDTGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVS 82

  Fly    71 RVYGQRIQREQSK 83
            |.|..|:|||::|
 Frog    83 RAYNSRLQRERAK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 44/58 (76%)
timm13NP_001039237.1 zf-Tim10_DDP 25..87 CDD:367270 45/61 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6717
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40846
Inparanoid 1 1.050 123 1.000 Inparanoid score I4580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm48422
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.