DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and Tim13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster


Alignment Length:81 Identity:62/81 - (76%)
Similarity:75/81 - (92%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDS 65
            ||.||::|||||:|||||||:|||||:|::|||||||||:.|||.||||:||:|||.|||||||:
  Fly     1 MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDA 65

  Fly    66 WNLISRVYGQRIQREQ 81
            |||:||.||.|:||||
  Fly    66 WNLVSRTYGNRLQREQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 46/58 (79%)
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 46/59 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470264
Domainoid 1 1.000 67 1.000 Domainoid score I3511
eggNOG 1 0.900 - - E1_KOG1733
Homologene 1 1.000 - - H40846
Inparanoid 1 1.050 71 1.000 Inparanoid score I2458
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59611
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm26152
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - P PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
1413.840

Return to query results.
Submit another query.