DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and TIMM13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_036590.1 Gene:TIMM13 / 26517 HGNCID:11816 Length:95 Species:Homo sapiens


Alignment Length:77 Identity:52/77 - (67%)
Similarity:67/77 - (87%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLIS 70
            :|.|.:|:|||.|||||||||||.:||:|||:||:.|||.|||:||||||:|||||:||:||.:|
Human    17 LDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVS 81

  Fly    71 RVYGQRIQREQS 82
            |.|..|:|||::
Human    82 RAYNSRLQRERA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 44/58 (76%)
TIMM13NP_036590.1 zf-Tim10_DDP 24..84 CDD:397210 44/59 (75%)
Twin CX3C motif 46..69 16/22 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159700
Domainoid 1 1.000 103 1.000 Domainoid score I6772
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40846
Inparanoid 1 1.050 119 1.000 Inparanoid score I4784
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59611
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm41208
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.