DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and tim13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_594597.1 Gene:tim13 / 2542145 PomBaseID:SPAC17C9.09c Length:95 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:38/81 - (46%)
Similarity:62/81 - (76%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AMANVDKGEL-MDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDS 65
            |.::.||..: |.|::|::|||.|.||::::.|.||.||:.:||::.|.:|:.|:|.||:|:||:
pombe    11 APSSEDKKSIFMKQIRQELAVAQAGELISKINENCFDKCIPEPGSTFDPNEKSCVSKCMERYMDA 75

  Fly    66 WNLISRVYGQRIQREQ 81
            ||::||.|..|:||||
pombe    76 WNIVSRTYISRMQREQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 28/58 (48%)
tim13NP_594597.1 zf-Tim10_DDP 23..83 CDD:281019 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2166
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1676
OMA 1 1.010 - - QHG59611
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm47223
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.