DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34132 and Timm13

DIOPT Version :9

Sequence 1:	NP_001036344.1	Gene:	CG34132 / 4379884	FlyBaseID:	FBgn0083968	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_665724.1	Gene:	Timm13 / 252928	RGDID:	628845	Length:	95	Species:	Rattus norvegicus

Alignment Length:	77	Identity:	52/77 - (67%)
Similarity:	67/77 - (87%)	Gaps:	0/77 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 VDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLIS 70
            :|.|.:|:|||.|||||||||||.:||:|||:||:.|||.|||:||||||:|||||:||:||.:|
  Rat    17 LDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVS 81

  Fly    71 RVYGQRIQREQS 82
            |.|..|:|||::
  Rat    82 RAYNSRLQRERA 93

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34132	NP_001036344.1	zf-Tim10_DDP	14..73	CDD:281019	44/58 (76%)
Timm13	NP_665724.1	zf-Tim10_DDP	24..84	CDD:397210	44/59 (75%)
Timm13	NP_665724.1	Twin CX3C motif	46..69		16/22 (73%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166353769
Domainoid	1	1.000	103	1.000	Domainoid score	I6620
eggNOG	1	0.900	-	-		E1_KOG1733
Hieranoid	1	1.000	-	-
Homologene	1	1.000	-	-		H40846
Inparanoid	1	1.050	120	1.000	Inparanoid score	I4678
OMA	1	1.010	-	-		QHG59611
OrthoDB	1	1.010	-	-		D1566384at2759
OrthoFinder	1	1.000	-	-		FOG0003493
OrthoInspector	1	1.000	-	-		otm45343
orthoMCL	1	0.900	-	-		OOG6_103836
Panther	1	1.100	-	-	LDO	PTHR19338
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X2854
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	16	15.770