DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34132 and tin-13

DIOPT Version :9

Sequence 1:NP_001036344.1 Gene:CG34132 / 4379884 FlyBaseID:FBgn0083968 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_492370.1 Gene:tin-13 / 172686 WormBaseID:WBGene00006574 Length:108 Species:Caenorhabditis elegans


Alignment Length:73 Identity:37/73 - (50%)
Similarity:55/73 - (75%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLISRVYG 74
            :::..||||.|:||||.|:|.::|||..||:..||:||.|.|::|:..||||||:||||:|:...
 Worm    20 QVISGVKQQAALANAQNLVTDISEKCTNKCITAPGSSLASGEKQCLQRCMDRFMESWNLVSQTLQ 84

  Fly    75 QRIQREQS 82
            :|:|.|.:
 Worm    85 KRLQEEMA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34132NP_001036344.1 zf-Tim10_DDP 14..73 CDD:281019 34/58 (59%)
tin-13NP_492370.1 zf-Tim10_DDP 25..83 CDD:397210 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167243
Domainoid 1 1.000 81 1.000 Domainoid score I5471
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3703
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59611
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm14248
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.