DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL34 and Mrpl34

DIOPT Version :10

Sequence 1:NP_001036552.1 Gene:mRpL34 / 4379878 FlyBaseID:FBgn0083983 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_444392.1 Gene:Mrpl34 / 94065 MGIID:2137227 Length:92 Species:Mus musculus


Alignment Length:39 Identity:20/39 - (51%)
Similarity:29/39 - (74%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH 81
            :|..:||.:.|||..|:|||.|.:|::.|:||||.:|||
Mouse    54 QPSNIKRKHKHGWVRRLSTPAGVQVILRRMLKGRKSLSH 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL34NP_001036552.1 Ribosomal_L34 44..80 CDD:425699 17/35 (49%)
Mrpl34NP_444392.1 Ribosomal_L34 50..91 CDD:425699 17/36 (47%)

Return to query results.
Submit another query.