DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL34 and MRPL34

DIOPT Version :10

Sequence 1:NP_001036552.1 Gene:mRpL34 / 4379878 FlyBaseID:FBgn0083983 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_076426.1 Gene:MRPL34 / 64981 HGNCID:14488 Length:92 Species:Homo sapiens


Alignment Length:46 Identity:23/46 - (50%)
Similarity:32/46 - (69%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVRCHFPKPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH 81
            |.|.:..:|..:||.|.|||..|:|||.|.:|::.|:||||.:|||
Human    47 KARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL34NP_001036552.1 Ribosomal_L34 44..80 CDD:425699 18/35 (51%)
MRPL34NP_076426.1 Ribosomal_L34 50..91 CDD:425699 18/40 (45%)

Return to query results.
Submit another query.