DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34130 and PRSS53

DIOPT Version :10

Sequence 1:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:86 Identity:22/86 - (25%)
Similarity:34/86 - (39%) Gaps:23/86 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 CQQL-AVENMGSLS------------LIAETSIVPNCQ-PSPSVDGFGTLVALDSHIIDSMSQS- 590
            |:.| |.|::..||            |:.||.:.|.|| .|..|.......|..||....::|: 
Human   277 CRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNR 341

  Fly   591 -------DDQNLLD-GILDVC 603
                   .:..|.| |:.::|
Human   342 FLLELQISNNRLEDAGVRELC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34130NP_001036759.1 Trypsin 53..263 CDD:459667
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 12/38 (32%)
Tryp_SPc 359..>512 CDD:473915 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.