DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34150 and AT3G62810

DIOPT Version :9

Sequence 1:NP_001036756.2 Gene:CG34150 / 4379863 FlyBaseID:FBgn0083986 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001325829.1 Gene:AT3G62810 / 825456 AraportID:AT3G62810 Length:106 Species:Arabidopsis thaliana


Alignment Length:104 Identity:27/104 - (25%)
Similarity:52/104 - (50%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESSEDEIQKMIKLAQDVDLELRTNV 71
            :.|.|::.|.|..:..|.||...|.|...:|.:.|.:||..:|..:|.::::.|::....:.|.:
plant     5 EALIAYRALLRATKKSFAGDTEMLKASASEIRKKFEENRLVASNSDITRLLEEAREATQFISTMI 69

  Fly    72 IQAQKKEDGVYELRITPETTRLDNVVFNPDAIIEKPRRQ 110
            :||:..|.|.||::.:.|         :..|.:|.|..:
plant    70 VQAKLNERGGYEMKASQE---------HAGATLELPSEE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34150NP_001036756.2 Complex1_LYR_LYRM7 8..79 CDD:380762 19/70 (27%)
AT3G62810NP_001325829.1 Complex1_LYR_LYRM7 6..77 CDD:380762 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I2665
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1585902at2759
OrthoFinder 1 1.000 - - FOG0007316
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104386
Panther 1 1.100 - - LDO PTHR46749
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.