DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34150 and Lyrm7

DIOPT Version :9

Sequence 1:NP_001036756.2 Gene:CG34150 / 4379863 FlyBaseID:FBgn0083986 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_038942762.1 Gene:Lyrm7 / 686506 RGDID:1596391 Length:132 Species:Rattus norvegicus


Alignment Length:104 Identity:45/104 - (43%)
Similarity:65/104 - (62%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESSEDEIQKMIKLAQDVDLELRTNV 71
            :||..||.||||||.||:.|..||.| |:||||.|.:::||:|.::|::|:|:..||:|.|||:|
  Rat    35 KVLQLFKTLHRTRQQVFKNDKRALEA-RVKINEEFKKHKNETSPEKIKEMLKIGSDVELLLRTSV 98

  Fly    72 IQAQKKEDGVY----ELRITPETTRLDNVVFNPDAIIEK 106
            ||      |::    .|::.|....|...|...||..:|
  Rat    99 IQ------GIHTDHDTLQLVPRKDLLTENVPYCDAPTQK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34150NP_001036756.2 Complex1_LYR_LYRM7 8..79 CDD:380762 37/70 (53%)
Lyrm7XP_038942762.1 Complex1_LYR_LYRM7 36..105 CDD:380762 38/75 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYPH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49648
OrthoDB 1 1.010 - - D1585902at2759
OrthoFinder 1 1.000 - - FOG0007316
OrthoInspector 1 1.000 - - oto98237
orthoMCL 1 0.900 - - OOG6_104386
Panther 1 1.100 - - LDO PTHR46749
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.