DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34150 and new18

DIOPT Version :9

Sequence 1:NP_001036756.2 Gene:CG34150 / 4379863 FlyBaseID:FBgn0083986 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001343167.1 Gene:new18 / 14217716 PomBaseID:SPBC30D10.21 Length:100 Species:Schizosaccharomyces pombe


Alignment Length:83 Identity:32/83 - (38%)
Similarity:45/83 - (54%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESSEDEIQKMIKLAQDVDLELRTNVIQAQK 76
            |:.|.|....||:||...|||.|.||...| .|....|.:|.:|.|:....|...||.||:||:|
pombe     8 FRNLWRASNSVFEGDPMILAAARDKIRTGF-HNHRCCSPEEAKKEIQNGNAVAEILRRNVVQAEK 71

  Fly    77 KEDGVYELRITPETTRLD 94
            :.:..|.|:|. :||.::
pombe    72 QSNDTYSLKIR-KTTEIN 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34150NP_001036756.2 Complex1_LYR_LYRM7 8..79 CDD:380762 27/66 (41%)
new18NP_001343167.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3466
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2065
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101852
orthoMCL 1 0.900 - - OOG6_104386
Panther 1 1.100 - - LDO PTHR46749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R787
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.