DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34150 and lyrm7

DIOPT Version :9

Sequence 1:NP_001036756.2 Gene:CG34150 / 4379863 FlyBaseID:FBgn0083986 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001092229.1 Gene:lyrm7 / 100002948 ZFINID:ZDB-GENE-070615-32 Length:104 Species:Danio rerio


Alignment Length:94 Identity:43/94 - (45%)
Similarity:65/94 - (69%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RRQVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESSEDEIQKMIKLAQDVDLELRT 69
            |.:||..||.|||||:.||:.|..||.|.|:||||.|.:|:||:|:|.|::|:|:|:.|:..||.
Zfish     4 RLKVLRVFKDLHRTRRDVFRDDNRALTAARVKINEEFKKNKNETSDDNIKEMLKMARAVETILRE 68

  Fly    70 NVIQAQKKEDGVYELRITPETTRLDNVVF 98
            :||||:..::....|| ..::..|:||.:
Zfish    69 SVIQAEHVDENKIVLR-PRKSLLLENVPY 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34150NP_001036756.2 Complex1_LYR_LYRM7 8..79 CDD:380762 37/70 (53%)
lyrm7NP_001092229.1 Complex1_LYR 6..60 CDD:283097 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYPH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5229
OMA 1 1.010 - - QHG49648
OrthoDB 1 1.010 - - D1585902at2759
OrthoFinder 1 1.000 - - FOG0007316
OrthoInspector 1 1.000 - - oto41382
orthoMCL 1 0.900 - - OOG6_104386
Panther 1 1.100 - - LDO PTHR46749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R787
SonicParanoid 1 1.000 - - X6205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.