DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muted and BLOC1S5

DIOPT Version :10

Sequence 1:NP_001036744.1 Gene:Muted / 4379860 FlyBaseID:FBgn0083967 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_958437.1 Gene:BLOC1S5 / 63915 HGNCID:18561 Length:187 Species:Homo sapiens


Alignment Length:157 Identity:42/157 - (26%)
Similarity:72/157 - (45%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RELYKVPLRILDHRVFVNGEIEAFLENFEVRRNDSEVEKLFQVTETVGSL-KYDLSRCSATGRGS 73
            ::|.::..|:||||..:.||...|::.||.:|...|:..|..:...:... ::.|.:|..|.|  
Human    37 KDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMR-- 99

  Fly    74 GAENLAQLDTEVSHLLDGVNALLAKAKVER--------TASTQ---LQEARLAREQ--RRAEFLT 125
              ::|:|:...:....|.| ..|.:.:.||        .||.:   ||.....:||  :|||  .
Human   100 --DSLSQVLQRLQAANDSV-CRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAE--V 159

  Fly   126 NLEHGYRRIENSFEEKEEEIAELYSDL 152
            :.||     ..:.|..:|:.||:..||
Human   160 DEEH-----RKAMERLKEQYAEMEKDL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MutedNP_001036744.1 Muted 10..156 CDD:464390 42/157 (27%)
BLOC1S5NP_958437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Muted 36..181 CDD:464390 40/155 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.