DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muted and Bloc1s5

DIOPT Version :10

Sequence 1:NP_001036744.1 Gene:Muted / 4379860 FlyBaseID:FBgn0083967 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_620702.1 Gene:Bloc1s5 / 17828 MGIID:2178598 Length:185 Species:Mus musculus


Alignment Length:154 Identity:40/154 - (25%)
Similarity:67/154 - (43%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RELYKVPLRILDHRVFVNGEIEAFLENFEVRRNDSEVEKLFQVTETVGSL-KYDLSRCSAT---G 70
            ::|.::..|:||||....|||..|::.||.:|...|:..|..:..|:... :..|.:|..|   |
Mouse    35 KDLGEIHSRLLDHRPVTQGEIRYFVKEFEEKRGLRELRVLKNLENTIQETNECLLPKCRETMECG 99

  Fly    71 RGSGAENLAQLDTEVSHLLDG-------VNALLAKAKVERTASTQLQEARLAREQRRAEFLTNLE 128
            .|...:.|...:..:..|...       :|..|..:  |:....|.:|....:.|||||    ::
Mouse   100 LGETLQRLQAANDSICRLQQREQERKKVINDYLTAS--EKRRLVQWEEFVSGQPQRRAE----VD 158

  Fly   129 HGYRRIENSFEEKEEEIAELYSDL 152
            ..:||   :.|...|:.|.:..||
Mouse   159 EEHRR---AVERLREQYAAMEKDL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MutedNP_001036744.1 Muted 10..156 CDD:464390 40/154 (26%)
Bloc1s5NP_620702.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Muted 34..179 CDD:464390 38/152 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.