DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and CEACAM1

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001703.2 Gene:CEACAM1 / 634 HGNCID:1814 Length:526 Species:Homo sapiens


Alignment Length:346 Identity:85/346 - (24%)
Similarity:143/346 - (41%) Gaps:50/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NSKLVVRNLSRIHQHAVYTCQASNFHKKYVATNITIDLYLRPLLVE--ISFNNQPMSADRKYEIE 269
            |:.|:::|::: :....||.|.  .....|....|...::.|.|.:  ||.||.....|:    :
Human   104 NASLLIQNVTQ-NDTGFYTLQV--IKSDLVNEEATGQFHVYP
ELPKPSISSNNSNPVEDK----D 161

  Fly   270 CQAIGSRPPAKIT---WWMGNLELHGHSQKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVR 331
            ..|....|..:.|   ||:.|..|....:....:||.:.::||:  ||.|.| ...|...|.:..
Human   162 AVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSV--TRNDTG-PYECEIQNPVSA 223

  Fly   332 NGIRETAMKLNVFFIPTLQLDLGSNLNPED--IEEGDDVYFECKVHANPAAYKVVWKHNHQIIQH 394
            |  |...:.|||.:.|..     ..::|.|  ...|.::...|...:||.| :..|..|....|.
Human   224 N--RSDPVTLNV
TYGPDT-----PTISPSDTYYRPGANLSLSCYAASNPPA-QYSWLINGTFQQS 280

  Fly   395 NQRAGVIVSSGDLALQGVTRHQAGNYTCTASN-VEGDGDSN-----VVELK-VMYKPICRPDQKK 452
            .|         :|.:..:|.:.:|:|||.|:| |.|...:.     |.||. |:.||..:..:..
Human   281 TQ---------ELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTT 336

  Fly   453 IYGVARNEAAEIVCEVDAFPPPENFKWSFNNTAETFDMPQSGFRPHSAQGSTLTYTPVKEMDFGT 517
            :.|  ..::..:.|..:  ....:.:|.|.|.:    :|.|.....|...:||:..|||..|.||
Human   337 VTG--DKDSVNLTCSTN--DTGISIRWFFKNQS----LPSSERMKLSQGNTTLSINPVKREDAGT 393

  Fly   518 IMCWADNNVGQ-QKEPCVFHL 537
            ..|...|.:.: |.:|.:.::
Human   394 YWCEVFNPISKNQSDPIMLNV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 6/22 (27%)
Ig 262..343 CDD:472250 21/83 (25%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 1/6 (17%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 0/2 (0%)
Ig_3 358..426 CDD:464046 18/69 (26%)
Ig_3 456..524 CDD:464046 16/67 (24%)
FN3 545..622 CDD:473895
CEACAM1NP_001703.2 IgV_CEACAM_D1 36..140 CDD:409430 8/38 (21%)
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Required for homophilic binding. /evidence=ECO:0000250|UniProtKB:P16573 39..142 8/40 (20%)
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430
Ig strand C' 78..83 CDD:409430
Ig strand C' 88..91 CDD:409430
FR3 98..124 CDD:409430 5/20 (25%)
Ig strand D 98..103 CDD:409430
Ig strand E 105..109 CDD:409430 1/3 (33%)
Ig strand F 119..124 CDD:409430 2/4 (50%)
CDR3 125..132 CDD:409430 1/6 (17%)
FR4 133..140 CDD:409430 1/6 (17%)
Ig strand G 133..139 CDD:409430 1/5 (20%)
IgI_hCEACAM_2_4_6_like 146..233 CDD:409402 25/95 (26%)
Ig strand A 146..150 CDD:409402 0/3 (0%)
Ig strand A' 153..158 CDD:409402 1/4 (25%)
Ig strand B 163..169 CDD:409402 1/5 (20%)
Ig strand C 176..181 CDD:409402 2/4 (50%)
Ig strand C' 183..186 CDD:409402 0/2 (0%)
Ig strand D 190..194 CDD:409402 0/3 (0%)
Ig strand E 197..202 CDD:409402 1/4 (25%)
Ig strand F 212..220 CDD:409402 1/7 (14%)
Ig strand G 224..233 CDD:409402 3/10 (30%)
IgC2_CEACAM5-like 243..318 CDD:409540 21/84 (25%)
Ig strand A 243..249 CDD:409540 2/5 (40%)
Ig strand B 254..261 CDD:409540 1/6 (17%)
Ig strand C 267..273 CDD:409540 2/6 (33%)
Ig strand C' 276..281 CDD:409540 1/4 (25%)
Ig strand E 284..290 CDD:409540 1/5 (20%)
Ig strand F 293..304 CDD:409540 5/10 (50%)
Ig strand G 307..318 CDD:409540 1/10 (10%)
Ig 327..415 CDD:472250 22/96 (23%)
Ig strand B 344..348 CDD:409353 0/3 (0%)
Ig strand C 357..361 CDD:409353 1/3 (33%)
Ig strand E 379..383 CDD:409353 2/3 (67%)
Ig strand F 393..398 CDD:409353 2/4 (50%)
Ig strand G 408..411 CDD:409353 1/2 (50%)
Interaction with calmodulin. /evidence=ECO:0000250|UniProtKB:P16573 450..462
Interaction with FLNA. /evidence=ECO:0000250|UniProtKB:P16573 452..526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 461..513
Required for interaction with PTPN11 and PTPN6 and for control of phosphorylation level. /evidence=ECO:0000250|UniProtKB:P31809 489..526
Essential for interaction with PTPN11 and PTPN6. /evidence=ECO:0000250|UniProtKB:P31809 520..523
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.