DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and NECTIN1

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_002846.3 Gene:NECTIN1 / 5818 HGNCID:9706 Length:517 Species:Homo sapiens


Alignment Length:314 Identity:67/314 - (21%)
Similarity:120/314 - (38%) Gaps:70/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SLEVTCVVYGGSPPPTVIWLMNGQLQNSVV----------------------DYTYDGAINSKLV 211
            |:::|.|.:..|        .||..||..:                      .:| ||.|     
Human    59 SVKITQVTWQKS--------TNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFT-DGTI----- 109

  Fly   212 VRNLSR--IHQHAVYTCQASNFHKKYVATNITIDLYLRPLL----VEISFNNQPMSADRKYEIEC 270
              .|||  :....||.|:.:.|......:.:.:.:..:|..    .:.....:....|:.....|
Human   110 --RLSRLELEDEGVYICEFATFPTGNRESQLNLTVM
AKPTNWIEGTQAVLRAKKGQDDKVLVATC 172

  Fly   271 QAIGSRPPAKITWWMGNLELHGHSQ-KVSEDGNVSTSVLS---ITPTREDHGKALSCRATNELVR 331
            .:...:||:.::|   ...|.|.:: :...:.|.:.:|:|   :.|:||.|.::|:|.....:.|
Human   173 TSANGKPPSVVSW---ETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDR 234

  Fly   332 NGIRETAMKLNVFFIPTLQLD-LGSNLNPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHN 395
              .:| ::.|||.:.|.:.:: ...|...:.:    ||...||..|||.|.:..|    ..:..:
Human   235 --FKE-SLTLNV
QYEPEVTIEGFDGNWYLQRM----DVKLTCKADANPPATEYHW----TTLNGS 288

  Fly   396 QRAGVIVSSGDLALQGVTRHQ-AGNYTCTASNV----EGDGDSNVVELKVMYKP 444
            ...||...:..|..:|...:. ||.|.|.|:|.    .|..:.|:.|..  |.|
Human   289 LPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFP--YTP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 18/84 (21%)
Ig 262..343 CDD:472250 19/84 (23%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 0/3 (0%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 18/68 (26%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
NECTIN1NP_002846.3 IgV_1_Nectin-1_like 31..143 CDD:409469 19/99 (19%)
FR1 31..54 CDD:409469
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469
Ig strand B 46..54 CDD:409469
CDR1 55..62 CDD:409469 1/2 (50%)
FR2 63..69 CDD:409469 2/5 (40%)
Ig strand C 64..69 CDD:409469 1/4 (25%)
CDR2 70..89 CDD:409469 5/26 (19%)
Ig strand C' 79..84 CDD:409469 0/4 (0%)
Ig strand C' 86..90 CDD:409469 0/3 (0%)
FR3 90..128 CDD:409469 10/45 (22%)
Ig strand D 97..101 CDD:409469 0/3 (0%)
Ig strand E 106..113 CDD:409469 4/13 (31%)
Ig strand F 120..128 CDD:409469 3/7 (43%)
CDR3 129..132 CDD:409469 1/2 (50%)
Ig strand G 132..142 CDD:409469 0/9 (0%)
FR4 133..143 CDD:409469 0/9 (0%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 20/102 (20%)
Ig strand A 146..152 CDD:143298 1/5 (20%)
Ig strand B 168..175 CDD:143298 1/6 (17%)
Ig strand C 180..186 CDD:143298 2/8 (25%)
Ig strand C' 188..190 CDD:143298 0/1 (0%)
Ig strand D 191..199 CDD:143298 1/7 (14%)
Ig strand E 205..213 CDD:143298 2/7 (29%)
Ig strand F 223..230 CDD:143298 2/6 (33%)
Ig strand G 234..240 CDD:143298 2/8 (25%)
Ig 247..333 CDD:472250 22/93 (24%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/7 (14%)
Interaction with FGFR. /evidence=ECO:0000250|UniProtKB:Q9JKF6 282..299 3/20 (15%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 330..333 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.