DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and CADM3

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:344 Identity:81/344 - (23%)
Similarity:134/344 - (38%) Gaps:102/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RCRV-DFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSR-----AGPYEEGGSL--------- 170
            :|:| |.:.|..:.||       |..|.:.|.|:|...|:|     :.|:|...|:         
Human   132 KCQVKDHEDSSLQWSN-------PAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEG 189

  Fly   171 EVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNFHKKY 235
            |.||.:: ..|..|                       :|.:|..|. |.|..:.|...|:..:|.
Human   190 EYTCSIF-TMPVRT-----------------------AKSLVTVLG-IPQKPIITGYKSSLREKD 229

  Fly   236 VATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKVSED 300
            .||                             :.||:.||:|.|::||..|:.||||...::.||
Human   230 TAT-----------------------------LNCQSSGSKPAARLTWRKGDQELHGEPTRIQED 265

  Fly   301 GN-----VSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPE 360
            .|     ||:|| :...||||.|.::.|...:|.::...|.|:.::.|.:.||..:    ..:|.
Human   266 PNGKTFTVSSSV-TFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMI----RPDPP 325

  Fly   361 DIEEGDDVYFECKVHANPAAYKVVWKHNHQI--IQHNQRAGVIVSSGDLALQGVTRHQAGNYTCT 423
            ...||..:...|:...||...:.:|:....:  ::..|.:.:|       ...:.:..:|.|.||
Human   326 HPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALI-------FPFLNKSDSGTYGCT 383

  Fly   424 ASNVEGDGDSNVVELKVMY 442
            |:       ||:...|..|
Human   384 AT-------SNMGSYKAYY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 6/19 (32%)
Ig_3 165..230 CDD:464046 13/73 (18%)
Ig 262..343 CDD:472250 29/85 (34%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 1/3 (33%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 14/69 (20%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
CADM3XP_024304528.1 IgV_1_Necl-1 115..209 CDD:143290 23/107 (21%)
Ig strand A 115..118 CDD:143290
FR1 116..134 CDD:143290 0/1 (0%)
Ig strand A' 119..125 CDD:143290
Ig strand B 127..135 CDD:143290 1/2 (50%)
CDR1 135..140 CDD:143290 2/4 (50%)
FR2 141..148 CDD:143290 3/13 (23%)
Ig strand C 141..147 CDD:143290 1/5 (20%)
CDR2 149..160 CDD:143290 3/10 (30%)
Ig strand C' 151..155 CDD:143290 1/3 (33%)
Ig strand C' 157..160 CDD:143290 1/2 (50%)
FR3 161..196 CDD:143290 8/34 (24%)
Ig strand D 165..172 CDD:143290 1/6 (17%)
Ig strand E 175..181 CDD:143290 2/5 (40%)
Ig strand F 188..196 CDD:143290 3/7 (43%)
CDR3 197..200 CDD:143290 0/2 (0%)
Ig strand G 200..209 CDD:143290 3/31 (10%)
FR4 202..209 CDD:143290 3/29 (10%)
IgI_2_Necl-1 210..312 CDD:409502 37/132 (28%)
Ig strand A 210..213 CDD:409502 1/3 (33%)
Ig strand A' 216..220 CDD:409502 0/3 (0%)
Ig strand B 229..239 CDD:409502 4/38 (11%)
Ig strand C 242..251 CDD:409502 4/8 (50%)
Ig strand C' 252..255 CDD:409502 0/2 (0%)
Ig strand D 258..265 CDD:409502 0/6 (0%)
Ig strand E 270..280 CDD:409502 4/10 (40%)
Ig strand F 288..296 CDD:409502 1/7 (14%)
Ig strand G 304..311 CDD:409502 2/6 (33%)
IG_like 328..399 CDD:214653 17/82 (21%)
Ig strand B 333..337 CDD:409504 0/3 (0%)
Ig strand C 347..351 CDD:409504 0/3 (0%)
Ig strand E 365..369 CDD:409504 1/10 (10%)
Ig strand F 379..384 CDD:409504 2/4 (50%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.