DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and sc:d0202

DIOPT Version :9

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001091722.2 Gene:sc:d0202 / 569842 ZFINID:ZDB-GENE-080226-9 Length:292 Species:Danio rerio


Alignment Length:240 Identity:66/240 - (27%)
Similarity:96/240 - (40%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SKLVVRNLSRIHQHAVYT--CQASNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIEC 270
            :.|:...:|.:....:||  |.. |:.|:.....:.:.:|..|..|.||..|..|.....||:.|
Zfish    71 ASLITWRVSELTDWDIYTPFCYI-NYDKQQCVVALPVTVYKTPDSVSISTVNLTMIEGNLYELLC 134

  Fly   271 QAIGSRPPAKIT--WWMGN--LELHGHSQKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVR 331
            ......|..|:|  |:.|.  ::....:.......| .||.|.|.|.|.|.|....|.|...|..
Zfish   135 DVHNVAPVQKLTVNWYKGETLVDQTNFTDTTKSPVN-KTSKLLIRPDRADDGAQYRCEAELNLGD 198

  Fly   332 NG------IRETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQ 390
            .|      :...:..:.|.:.|.      .:.:.|.|.:.|||...|.|.|||||. ..|...|.
Zfish   199 EGPQHPPTVTSKSFSIKVHYKPK------HSRSTEKISQSDDVSLNCTVKANPAAV-YTWHSKHL 256

  Fly   391 IIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCTASNVEGDGDSNV 435
            |   .:.:..::.|..|:        .|||||||:|..|: ||.|
Zfish   257 I---EKISSSVIQSSTLS--------PGNYTCTAANYLGE-DSKV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 157..230 CDD:290638 5/23 (22%)
IG_like 165..242 CDD:214653 7/35 (20%)
Ig 265..343 CDD:299845 21/87 (24%)
IG_like 267..343 CDD:214653 20/85 (24%)
IG_like 363..440 CDD:214653 27/73 (37%)
IGc2 364..429 CDD:197706 23/64 (36%)
IG_like 456..532 CDD:214653
Ig_3 456..524 CDD:290638
fn3 545..622 CDD:278470
sc:d0202NP_001091722.2 Ig 112..211 CDD:325142 27/99 (27%)
Ig_2 219..292 CDD:316418 30/90 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.