DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and side-IV

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster


Alignment Length:213 Identity:40/213 - (18%)
Similarity:73/213 - (34%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FANHSGTDILPYFSENVEKCVQ-------------------------NQFNSTCNEYKEESCVTR 138
            |..:...|::|...:||.|.|.                         .:.....||....|.::|
  Fly   674 FERNEQDDVVPLAEKNVRKAVTRLGGTMPKGQRIDAYLDSMRRVDSWKESTDADNEGAGSSSLSR 738

  Fly   139 ---NEMLDD------------------NGADIFGLQLAYKLMEKYLSGRLE----ERIERLNVTQ 178
               |:.||.                  :|.::|..|:..||.::..:..|:    :..:....::
  Fly   739 TVSNDSLDTLPLPDSMNSSTYVKMHPASGENVFLRQIRSKLKKRSETPELDHIDSDTADETTKSE 803

  Fly   179 EQLFFYSFANQFCSGSLSKVFIEEEGDYDPH-SVNNVRVNAVAQHPGFRKAFNCPDNSRMMKSA- 241
            :..|          |||:|..|:......|. |.|:.||:.|...|....:.:...:|:...|: 
  Fly   804 KSPF----------GSLNKSSIKYPIKNAPEFSENHSRVSPVPVPPSRNASVSVRPDSKAEDSSD 858

  Fly   242 --TEQCIIYGENAPETRK 257
              |:...::|.....|||
  Fly   859 ETTKDVGMWGPKHAVTRK 876

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 11/68 (16%)
Ig_3 165..230 CDD:464046 14/69 (20%)
Ig 262..343 CDD:472250
Ig strand B 266..270 CDD:409416
Ig strand C 280..284 CDD:409416
Ig strand F 320..325 CDD:409416
Ig strand G 336..339 CDD:409416
Ig_3 358..426 CDD:464046
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
side-IVNP_001034052.2 V-set 79..188 CDD:462230
Ig 210..281 CDD:472250
Ig strand B 218..222 CDD:409353
Ig strand C 232..236 CDD:409353
Ig <317..392 CDD:472250
Ig strand C 329..333 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 385..388 CDD:409353
Ig 411..479 CDD:472250
Ig strand B 417..421 CDD:409353
Ig strand C 431..435 CDD:409353
Ig strand E 454..458 CDD:409353
Ig strand F 468..473 CDD:409353
Ig 494..576 CDD:472250
Ig strand B 511..515 CDD:409353
Ig strand C 525..529 CDD:409353
Ig strand E 551..555 CDD:409353
Ig strand F 566..570 CDD:409353