DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and Cadm3

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001399746.1 Gene:Cadm3 / 360882 RGDID:1307035 Length:430 Species:Rattus norvegicus


Alignment Length:397 Identity:90/397 - (22%)
Similarity:154/397 - (38%) Gaps:113/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SYDTRGAHAGTPSHWRDEEV-------LEDRAVFRTHKEPAELIIN----PVKEKD---AGN--- 119
            |:...||:.....:|:::::       ||: |:..|.....:|:.:    |....:   ||.   
  Rat    16 SWAPGGANLSQDGYWQEQDLELGTPAPLEE-ALSSTVWSNPDLLASQDSQPWTSDETVVAGGTVV 79

  Fly   120 FRCRV-DFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSR-----AGPYEEGGSL-------- 170
            .:|:| |.:.|..:.||       |..|.:.|.|:|...|:|     :.|:|...|:        
  Rat    80 LKCQVKDHEDSSLQWSN-------PAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADE 137

  Fly   171 -EVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNFHKK 234
             |.||.:: ..|..|                       :|.:|..|. |.|..:.|...|:..:|
  Rat   138 GEYTCSIF-TMPVRT-----------------------AKSLVTVLG-IPQKPIITGYKSSLREK 177

  Fly   235 YVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKVSE 299
            ..||                             :.||:.||:|.|::.|..|:.||||...::.|
  Rat   178 ETAT-----------------------------LNCQSSGSKPAAQLAWRKGDQELHGDQTRIQE 213

  Fly   300 DGN-----VSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNP 359
            |.|     ||:|| |...||:|.|..:.|...:|.::...|.|:.::.|.:.||..:    ...|
  Rat   214 DPNGKTFTVSSSV-SFQVTRDDDGANVVCSVNHESLKGADRSTSQRIEVLYTPTAMI----RPEP 273

  Fly   360 EDIEEGDDVYFECKVHANPAAYKVVW--KHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTC 422
            ....||..:...|:...||...:.||  :.:...::..|.:.:|       ...:.:..:|.|.|
  Rat   274 AHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALI-------FPFLNKSDSGTYGC 331

  Fly   423 TASNVEG 429
            ||::..|
  Rat   332 TATSNMG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 18/85 (21%)
Ig_3 165..230 CDD:464046 13/73 (18%)
Ig 262..343 CDD:472250 28/85 (33%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 0/3 (0%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 15/69 (22%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
Cadm3NP_001399746.1 IgV_1_Necl-1 64..158 CDD:143290 26/124 (21%)
Ig strand A 64..67 CDD:143290 1/2 (50%)
FR1 65..83 CDD:143290 3/17 (18%)
Ig strand A' 68..74 CDD:143290 0/5 (0%)
Ig strand B 76..84 CDD:143290 1/7 (14%)
CDR1 84..89 CDD:143290 2/4 (50%)
FR2 90..97 CDD:143290 3/13 (23%)
Ig strand C 90..96 CDD:143290 1/5 (20%)
CDR2 98..109 CDD:143290 3/10 (30%)
Ig strand C' 100..104 CDD:143290 1/3 (33%)
Ig strand C' 106..109 CDD:143290 1/2 (50%)
FR3 110..145 CDD:143290 8/34 (24%)
Ig strand D 114..121 CDD:143290 1/6 (17%)
Ig strand E 124..130 CDD:143290 2/5 (40%)
Ig strand F 137..145 CDD:143290 3/7 (43%)
CDR3 146..149 CDD:143290 0/2 (0%)
Ig strand G 149..158 CDD:143290 3/31 (10%)
FR4 151..158 CDD:143290 3/29 (10%)
Ig 159..261 CDD:472250 36/132 (27%)
Ig strand B 180..184 CDD:409353 2/32 (6%)
Ig strand C 194..198 CDD:409353 0/3 (0%)
Ig strand E 224..228 CDD:409353 2/4 (50%)
Ig strand F 238..243 CDD:409353 1/4 (25%)
Ig strand G 254..257 CDD:409353 1/2 (50%)
IG_like 271..348 CDD:214653 16/75 (21%)
Ig strand B 282..286 CDD:409353 0/3 (0%)
Ig strand C 296..300 CDD:409353 1/3 (33%)
Ig strand E 314..318 CDD:409353 1/10 (10%)
Ig strand F 328..333 CDD:409353 2/4 (50%)
4.1m 386..401 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.