DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and ICAM2

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_000864.2 Gene:ICAM2 / 3384 HGNCID:5345 Length:275 Species:Homo sapiens


Alignment Length:176 Identity:44/176 - (25%)
Similarity:71/176 - (40%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 EEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSK-LVVRNLSRIHQHAV---YT 225
            |..|||||.|......|..       |.|:.|:.....|.....| .:|.|:|  |...:   :|
Human    39 EPKGSLEVNCSTTCNQPEV-------GGLETSLDKILLDEQAQWKHYLVSNIS--HDTVLQCHFT 94

  Fly   226 CQASNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWM--GNL 288
            |..     |..:.|..:.:|..|..|.::.....::..:.:.|||:.....|...:|.::  ||.
Human    95 CSG-----KQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNE 154

  Fly   289 ELHGHS-QKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVRNG 333
            .||..: .|.:.....:|:..:.|..|||..:..||.|..:|:..|
Human   155 TLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRG 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 19/68 (28%)
Ig 262..343 CDD:472250 20/75 (27%)
Ig strand B 266..270 CDD:409416 1/3 (33%)
Ig strand C 280..284 CDD:409416 1/3 (33%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416
Ig_3 358..426 CDD:464046
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
ICAM2NP_000864.2 IgI_N_ICAM-2 27..109 CDD:409587 21/83 (25%)
Ig strand A 29..32 CDD:409587
Ig strand A' 35..38 CDD:409587
Ig strand B 43..49 CDD:409587 4/5 (80%)
Ig strand C 56..61 CDD:409587 1/11 (9%)