DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and Ceacam2

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001106839.1 Gene:Ceacam2 / 26367 MGIID:1347246 Length:520 Species:Mus musculus


Alignment Length:571 Identity:123/571 - (21%)
Similarity:196/571 - (34%) Gaps:180/571 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYG------------GSPPPTVIWLMNGQLQN 195
            |||        ..::...|.|........|..|||.            ||...|     |.::..
Mouse    30 PPT--------TAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTST-----NAEIVR 81

  Fly   196 SV--VDYTYDGAI---------NSKLVVRNLSRIHQHAVYTCQASNFHKKYVATNITIDLYLRPL 249
            .|  .:.|..|.:         |..|:::.:: :....|||.:.::  :.|....:|...::..|
Mouse    82 FVTGTNKTIKGPVHSGRETLYSNGSLLIQRVT-MKDTGVYTIEMTD--QNYRRRVLTGQFHVHTL 143

  Fly   250 LVE---ISFNNQPMSADRKYEIECQAIGSRPPAKITW-WMGNLE--LHGHSQKVSEDGNVSTSVL 308
            |::   .|.|:.|:..|....:.|.:.  ..|..||: |..|.|  ..|...|:|| ||.:.::|
Mouse   144 LLKSNITSNNSNPVEGDDSVSLTCDSY--TDPDNITYLWSRNGESLSEGDRLKLSE-GNRTLTLL 205

  Fly   309 SITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPEDI--EEGDDVYFE 371
            ::  ||.|.|..: |...|.:..|  |.....||:.:.|...:     ::|.||  ..|.::...
Mouse   206 NV--TRNDTGPYV-CETRNPVSVN--RSDPFSLNIIYGPDTPI-----ISPSDIYLHPGSNLNLS 260

  Fly   372 CKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCTASN-VEGDGDSNV 435
            |...:||.| :..|..|.:  .|       .||.:|.:..:|.:.:|.|||..:| |.|...:.|
Mouse   261 CHAASNPPA-QYFWLINEK--PH-------ASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTV 315

  Fly   436 VELKVMYKPICRP------------DQKKIYGVARNEAAEIVCEVDAFPPPENFKWSFNN----T 484
            ..:.|: :|:.:|            |...:..::::..|.|             .|.|||    .
Mouse   316 KNITVL-EPVTQPSLQVTNTTVKELDSVTLTCLSKDRQAHI-------------HWIFNNDTLLI 366

  Fly   485 AETFDMPQSGFRPHSAQGSTLTYTPVKEMDFGTIMCWADNNVGQQKEPCVFHLIAAGKPEAPTNC 549
            .|.....|:|.        .|...|:|..|.|...|...|.|                       
Mouse   367 TEKMTTSQAGL--------ILKIDPIKREDAGEYQCEISNPV----------------------- 400

  Fly   550 TVVNQTSDSLEVYCIEGFDGGMRQWFLMEIFDQHSGQLQANISAKFAALSVTGLDAGRLFRIYVY 614
            :|....|..|||                 |||.     ..:||....|:.:||..||        
Mouse   401 SVKRSNSIKLEV-----------------IFDS-----TYDISDVPIAVIITGAVAG-------- 435

  Fly   615 AVNGRGRSDAIALDGYTLKAAEKQT------VALTSYKGSAQSPDNFELTP 659
                     .|.:.|...:...:::      ..||.:|.||   .|..|.|
Mouse   436 ---------VILIAGLAYRLCSRKSRWGSDQRDLTEHKPSA---SNHNLAP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 16/87 (18%)
Ig 262..343 CDD:472250 24/83 (29%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 2/4 (50%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 0/2 (0%)
Ig_3 358..426 CDD:464046 19/69 (28%)
Ig_3 456..524 CDD:464046 15/71 (21%)
FN3 545..622 CDD:473895 15/76 (20%)
Ceacam2NP_001106839.1 IgV_CEACAM_D1 36..140 CDD:409430 20/111 (18%)
FR1 37..55 CDD:409430 3/17 (18%)
Ig strand A 37..39 CDD:409430 0/1 (0%)
Ig strand A' 44..46 CDD:409430 0/1 (0%)
Ig strand B 49..56 CDD:409430 2/6 (33%)
CDR1 56..63 CDD:409430 1/6 (17%)
FR2 64..69 CDD:409430 0/4 (0%)
Ig strand C 64..68 CDD:409430 0/3 (0%)
CDR2 70..91 CDD:409430 6/25 (24%)
Ig strand C' 78..83 CDD:409430 0/4 (0%)
Ig strand C' 88..91 CDD:409430 1/2 (50%)
FR3 98..124 CDD:409430 5/26 (19%)
Ig strand D 98..103 CDD:409430 0/4 (0%)
Ig strand E 105..109 CDD:409430 1/3 (33%)
Ig strand F 119..124 CDD:409430 3/4 (75%)
CDR3 125..132 CDD:409430 1/8 (13%)
FR4 133..140 CDD:409430 1/6 (17%)
Ig strand G 133..139 CDD:409430 1/5 (20%)
IgI_hCEACAM_2_4_6_like 146..236 CDD:409402 28/97 (29%)
Ig strand A 146..150 CDD:409402 0/3 (0%)
Ig strand A' 153..158 CDD:409402 2/4 (50%)
Ig strand B 163..169 CDD:409402 1/5 (20%)
Ig strand C 178..183 CDD:409402 1/4 (25%)
Ig strand C' 185..188 CDD:409402 1/2 (50%)
Ig strand D 192..196 CDD:409402 1/3 (33%)
Ig strand E 199..204 CDD:409402 1/4 (25%)
Ig strand F 214..222 CDD:409402 1/8 (13%)
Ig strand G 226..235 CDD:409402 3/10 (30%)
IgC2_CEACAM5-like 245..320 CDD:409540 23/84 (27%)
Ig strand A 245..251 CDD:409540 3/5 (60%)
Ig strand B 256..263 CDD:409540 1/6 (17%)
Ig strand C 269..275 CDD:409540 2/6 (33%)
Ig strand C' 278..283 CDD:409540 1/13 (8%)
Ig strand E 286..292 CDD:409540 1/5 (20%)
Ig strand F 295..306 CDD:409540 4/10 (40%)
Ig strand G 309..320 CDD:409540 2/10 (20%)
Ig 326..413 CDD:472250 24/147 (16%)
Ig strand B 342..346 CDD:409353 0/3 (0%)
Ig strand C 355..359 CDD:409353 2/16 (13%)
Ig strand E 377..381 CDD:409353 1/11 (9%)
Ig strand F 391..396 CDD:409353 1/4 (25%)
Ig strand G 406..409 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..520 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.