DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and CADM1

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:336 Identity:79/336 - (23%)
Similarity:132/336 - (39%) Gaps:59/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVV 176
            |.|.:.....|:|:      ::.:..::::.|..|.|.|.:.|...|||.               
Human    60 VIEGEVATISCQVN------KSDDSVIQLLNPNRQTIYFRDFRPLKDSRF--------------- 103

  Fly   177 YGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNFHKKYVATNIT 241
                           ||.|.       .:...|:.:.|:| |.....|.||......:...|.||
Human   104 ---------------QLLNF-------SSSELKVSLTNVS-ISDEGRYFCQLYTDPPQESYTTIT 145

  Fly   242 IDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKVSE--DGNVS 304
            :.:..|.|:::|  .........:.|:.|.|:.|:|...|.|:.||.||.|.|: |.|  |....
Human   146 VLVPPRNLMIDI--QKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSE-VEEWSDMYTV 207

  Fly   305 TSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDDVY 369
            ||.|.:...:||.|..:.|:..:..| .|..:|...|.|.:.|.:.:.:...|... ..|||.:.
Human   208 TSQLMLKVHKEDDGVPVICQVEHPAV-TGNLQTQRYLEVQYKPQVHIQMTYPLQGL-TREGDALE 270

  Fly   370 FECKVHANPAAYKVVW-KHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCTASNVEGDGDS 433
            ..|:....|....|.| :.:.::.||     .::|..:|.:..:.:...|.|.|.|||:.|...|
Human   271 LTCEAIGKPQPVMVTWVRVDDEMPQH-----AVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHS 330

  Fly   434 NVVELKVMYKP 444
            :.  :..:|.|
Human   331 DY--MLYVYDP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 4/27 (15%)
Ig_3 165..230 CDD:464046 10/64 (16%)
Ig 262..343 CDD:472250 27/82 (33%)
Ig strand B 266..270 CDD:409416 1/3 (33%)
Ig strand C 280..284 CDD:409416 1/3 (33%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 15/68 (22%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
CADM1XP_016872946.1 IgV_1_Necl-2 53..146 CDD:409465 24/129 (19%)
FR1 53..71 CDD:409465 2/10 (20%)
Ig strand A 53..55 CDD:409465
Ig strand A' 56..62 CDD:409465 1/1 (100%)
Ig strand B 64..72 CDD:409465 1/7 (14%)
CDR1 72..77 CDD:409465 1/10 (10%)
FR2 78..85 CDD:409465 0/6 (0%)
Ig strand C 78..84 CDD:409465 0/5 (0%)
CDR2 86..97 CDD:409465 3/10 (30%)
Ig strand C' 88..92 CDD:409465 2/3 (67%)
Ig strand C' 94..97 CDD:409465 0/2 (0%)
FR3 98..133 CDD:409465 13/72 (18%)
Ig strand D 102..109 CDD:409465 4/43 (9%)
Ig strand E 112..118 CDD:409465 1/5 (20%)
Ig strand F 125..133 CDD:409465 3/7 (43%)
CDR3 134..137 CDD:409465 0/2 (0%)
Ig strand G 137..146 CDD:409465 2/8 (25%)
FR4 139..146 CDD:409465 2/6 (33%)
IgI_2_Necl-2 147..245 CDD:409466 30/101 (30%)
Ig strand A 147..150 CDD:409466 0/2 (0%)
Ig strand A' 153..157 CDD:409466 1/3 (33%)
Ig strand B 166..176 CDD:409466 3/9 (33%)
Ig strand C 179..188 CDD:409466 3/8 (38%)
Ig strand C' 189..192 CDD:409466 1/2 (50%)
Ig strand D 194..201 CDD:409466 3/7 (43%)
Ig strand E 204..214 CDD:409466 3/9 (33%)
Ig strand F 222..230 CDD:409466 1/7 (14%)
Ig strand G 237..244 CDD:409466 1/6 (17%)
IG_like 258..336 CDD:214653 20/85 (24%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 282..287 CDD:409353 1/4 (25%)
Ig strand E 301..306 CDD:409353 1/4 (25%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 1/2 (50%)
4.1m 430..448 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.