DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and Siglec1

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_036015809.1 Gene:Siglec1 / 20612 MGIID:99668 Length:1719 Species:Mus musculus


Alignment Length:1347 Identity:261/1347 - (19%)
Similarity:425/1347 - (31%) Gaps:450/1347 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVNSSAQIKCDVGSSQADDKV---LLVVWYKNNLPIYSYDTRG-----AHAGTPSHWRDEEVLED 94
            |..|...|.| :.|..||..|   :..:||        ||..|     .|:|.|.       |.|
Mouse    38 LSGSCLLIPC-IFSYPADVPVSNGITAIWY--------YDYSGKRQVVIHSGDPK-------LVD 86

  Fly    95 RAVFRTHKE--------PAELIINPVKEKDAGNFRCRVDFKLSQTRN----SNVNLEVVVPPTQP 147
            :. ||...|        ...|::..:|.:|:|.:..|  |::|.:..    ....:.|...|:.|
Mouse    87 KR-FRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFR--FEISDSNRWLDVKGTTVTVTTDPSPP 148

  Fly   148 IIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVV 212
            .|.....||         ||......|     |.|    :|.   ||...|...:.|...:..|.
Mouse   149 TITIPEELR---------EGMERNFNC-----STP----YLC---LQEKQVSLQWRGQDPTHSVT 192

  Fly   213 RNLSRI------HQHAVYTCQASNFHKKYVATNITI-------DLYLR----PLLVEI--SFNNQ 258
            .:...:      ||..::...:...|.:.:....::       ::||:    |..|||  |.:.:
Mouse   193 SSFQSLEPTGVYHQTTLHMALSWQDHGRTLLCQFSLGAHSSRKEVYLQVPHAPKGVEILLSSSGR 257

  Fly   259 PMSADRKYEIECQAIGSRPPAKITWWMG---NLELHGHSQKVSEDGNVSTSVLSITPTREDHGKA 320
            .:.......:.|:...|.|......|..   ||.:.||             ||.:.....:...|
Mouse   258 NILPGDPVTLTCRVNSSYPAVSAVQWARDGVNLGVTGH-------------VLRLFSAAWNDSGA 309

  Fly   321 LSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPE-DIEEGDDVYFECKVHAN-PAAYKV 383
            .:|:|||::  ..:..:.:.|:||....       .:||. .:.|.:.|...|..... |...:.
Mouse   310 YTCQATNDM--GSLVSSPLSLHVFMAEV-------KMNPAGPVLENETVTLLCSTPKEAPQELRY 365

  Fly   384 VWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCTASNVEGDGDSNVVELKVMYKPICRP 448
            .|..||.:::.       ..:..|.|..|||...|.|.|...|.:|...|:.:.:.|.|.|: .|
Mouse   366 SWYKNHILLED-------AHASTLHLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPL-TP 422

  Fly   449 D-------QKKIYG--------------------------------------------------- 455
            |       |..:.|                                                   
Mouse   423 DLTTFLETQAGLVGILHCSVVSEPLATVVLSHGGLTLASNSGENDFNPRFRISSAPNSLRLEIRD 487

  Fly   456 -----------------------------VAR---NEAAEIV--------CEVDAFPPPE-NFKW 479
                                         |||   |.:||:|        |.....|.|: .|.|
Mouse   488 LQPADSGEYTCLAVNSLGNSTSSLDFYANVARLLINPSAEVVEGQAVTLSCRSGLSPAPDTRFSW 552

  Fly   480 SFN------NTAETFDMP--------------QSGFRPHSAQGS-----TLTYTPVK-------E 512
            ..|      .::.:..:|              |:|  |:::..|     |:.|.|.|       :
Mouse   553 YLNGALLLEGSSSSLLLPAASSTDAGSYYCRTQAG--PNTSGPSLPTVLTVFYPPRKPTFTARLD 615

  Fly   513 MDF--------GTIMCWADNNVGQQKEPCVF------HLIAAGKPEAPTNC---TVVNQTSDSLE 560
            :|.        |.::|..|::     .|...      |::|...|....:|   |.|::||:||.
Mouse   616 LDTSGVGDGRRGILLCHVDSD-----PPAQLRLLHKGHVVATSLPSRCGSCSQRTKVSRTSNSLH 675

  Fly   561 VY----CIEGFDGGMRQWFLMEIFDQ-HSGQLQANISAKFAALSVT-------GLDAGRLFRI-- 611
            |.    .:|  |.|:   :|.|..:. .:....|:.:||...|.:|       |.:|.....:  
Mouse   676 VEIQKPVLE--DEGV---YLCEASNTLGNSSAAASFNAKATVLVITPSNTLREGTEANLTCNVNQ 735

  Fly   612 --------YVYAVNG----RGRSDAIALDGYTLKAAEKQTVALTSYKGSAQS----------PDN 654
                    :.:..||    :|..:.:.|.......|......|.:..|:..|          ||.
Mouse   736 EVAVSPANFSWFRNGVLWTQGSLETVRLQPVARTDAAVYACRLLTEDGAQLSAPVVLSVLYAPDP 800

  Fly   655 FELTPILSIGIFVGILVAIVC-IGIGTIAALKLRSHKHQQQQKFVHPNAKFSRPGNLQIKDKI-- 716
            .:|:.:|.:|  .|.:...:| :....:|.|.|....|     .:..|.:..||.:.:|:.|.  
Mouse   801 PKLSALLDVG--QGHMAVFICTVDSYPLAHLSLFRGDH-----LLATNLEPQRPSHGRIQAKATA 858

  Fly   717 -SLPLSHSE-EMYDEKNPDVVPYN-----------EVDGEYKQKSATQTPSGHLSTTSEVEISCK 768
             ||.|...| .:.|..|......|           :|.|.:.|.|    ||..|.....|.:||:
Mouse   859 NSLQLEVRELGLVDSGNYHCEATNILGSANSSLFFQVRGAWVQVS----PSPELREGQAVVLSCQ 919

  Fly   769 -PGSTSGTGIVQANS----ADSGTYQSSKDDELHYAELSLTNMPSGSSGASKKGQPMGGVGV--- 825
             |     ||:.:..|    .|....|.|....|..|.:||....:....|......:..:..   
Mouse   920 VP-----TGVSEGTSYSWYQDGRPLQESTSSTLRIAAISLRQAGAYHCQAQAPDTAIASLAAPVS 979

  Fly   826 ----------------------VQHVVQQQQQQQQGQVQ--HPHQLLGGTLP-----HGSSMRKL 861
                                  :.|:|...|.....|:|  |.::|:..||.     .||:.|..
Mouse   980 LHVSYTPRHVTLSALLSTDPERLGHLVCSVQSDPPAQLQLFHRNRLVASTLQGADELAGSNPRLH 1044

  Fly   862 LPTIPATATLQRHKPNAGGMQHPHQHAPPPTY---------------DYD-YFEEPTIYAQIDAY 910
            :..:|....||.|.|         :.....||               |:| .....|::......
Mouse  1045 VTVLPNELRLQIHFP---------ELEDDGTYTCEASNTLGQASAAADFDAQAVRVTVWPNATVQ 1100

  Fly   911 KTMQVDTGVVVAGVGAGA--------GSGVNGAGASISSPGSHGTPSTVSPGTVQMYT----LPQ 963
            :..||:...:|......:        |..:.|| .||:.|......:|       .|.    ||.
Mouse  1101 EGQQVNLTCLVWSTHQDSLSYTWYKGGQQLLGA-RSITLPSVKVLDAT-------SYRCGVGLPG 1157

  Fly   964 HPGGYHTLPH-NHHAQQQMAGGPQNSASMMQMMQQQQQQQQQMHHHPASNMPPSYQQHQQQQQQQ 1027
            |      .|| :......:...|:|  ..:..:.:.|.:|..:......:.||:         |.
Mouse  1158 H------APHLSRPVTLDVLHAPRN--LRLTYLLETQGRQLALVLCTVDSRPPA---------QL 1205

  Fly  1028 QMAHGQMLVSSNSSGLASTT--AAVASPSSSLSGL------SGVGKS 1066
            .::||..||:|::......|  ..:..|..|..||      |.:||:
Mouse  1206 TLSHGDQLVASSTEASVPNTLRLELQDPRPSNEGLYSCSAHSPLGKA 1252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 28/121 (23%)
Ig_3 165..230 CDD:464046 13/70 (19%)
Ig 262..343 CDD:472250 16/83 (19%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 0/3 (0%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416 0/2 (0%)
Ig_3 358..426 CDD:464046 17/69 (25%)
Ig_3 456..524 CDD:464046 25/119 (21%)
FN3 545..622 CDD:473895 23/105 (22%)
Siglec1XP_036015809.1 IgV_CD33 27..134 CDD:409377 28/114 (25%)
FR1 27..51 CDD:409377 4/13 (31%)
Ig strand A 27..31 CDD:409377
Ig strand A' 34..38 CDD:409377 261/1347 (19%)
Ig strand B 40..51 CDD:409377 3/11 (27%)
CDR1 52..60 CDD:409377 3/7 (43%)
FR2 61..68 CDD:409377 2/14 (14%)
Ig strand C 61..68 CDD:409377 2/14 (14%)
CDR2 69..90 CDD:409377 6/28 (21%)
Ig strand C' 77..80 CDD:409377 1/2 (50%)
FR3 91..124 CDD:409377 6/34 (18%)
Ig strand D 92..96 CDD:409377 1/3 (33%)
Ig strand E 102..110 CDD:409377 1/7 (14%)
Ig strand F 117..125 CDD:409377 3/9 (33%)
CDR3 125..129 CDD:409377 1/3 (33%)
C2-set_2 148..235 CDD:400489 18/107 (17%)
Ig strand B 162..166 CDD:409353 0/3 (0%)
Ig strand C 179..183 CDD:409353 0/3 (0%)
Ig strand E 207..211 CDD:409353 0/3 (0%)
Ig strand F 221..226 CDD:409353 0/4 (0%)
Ig strand G 234..237 CDD:409353 0/2 (0%)
Ig 245..330 CDD:472250 21/99 (21%)
Ig strand B 265..269 CDD:409353 0/3 (0%)
Ig strand C 280..284 CDD:409353 0/3 (0%)
Ig strand E 296..299 CDD:409353 2/2 (100%)
Ig strand F 309..314 CDD:409353 2/4 (50%)
Ig strand G 323..326 CDD:409353 0/2 (0%)
Ig 334..417 CDD:472250 21/96 (22%)
Ig strand B 349..353 CDD:409353 1/3 (33%)
Ig strand C 364..368 CDD:409353 0/3 (0%)
Ig strand E 380..384 CDD:409353 1/3 (33%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 408..411 CDD:409353 1/2 (50%)
Ig 428..511 CDD:472250 2/82 (2%)
Ig strand B 436..440 CDD:409353 1/3 (33%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 480..485 CDD:409353 0/4 (0%)
Ig strand F 495..500 CDD:409353 0/4 (0%)
Ig_3 523..583 CDD:464046 11/59 (19%)
IG_like 624..702 CDD:214653 20/87 (23%)
Ig strand C 640..644 CDD:409353 0/3 (0%)
Ig strand E 674..678 CDD:409353 2/3 (67%)
Ig strand F 688..693 CDD:409353 1/7 (14%)
Ig_3 712..777 CDD:464046 9/64 (14%)
Ig 815..895 CDD:472250 17/84 (20%)
Ig strand B 815..819 CDD:409353 0/3 (0%)
Ig strand C 828..832 CDD:409353 1/3 (33%)
Ig strand E 861..865 CDD:409353 2/3 (67%)
Ig strand F 875..880 CDD:409353 1/4 (25%)
Ig_2 903..982 CDD:464026 19/87 (22%)
IG_like 1005..1093 CDD:214653 20/96 (21%)
Ig strand C 1026..1030 CDD:409353 0/3 (0%)
Ig strand E 1051..1056 CDD:409353 1/4 (25%)
Ig strand F 1066..1071 CDD:409353 2/4 (50%)
Ig strand G 1079..1082 CDD:409353 0/2 (0%)
Ig_2 1095..1170 CDD:464026 16/88 (18%)
IG_like 1195..1258 CDD:214653 16/67 (24%)
Ig strand C 1204..1208 CDD:409353 1/3 (33%)
Ig strand E 1226..1230 CDD:409353 0/3 (0%)
Ig strand F 1240..1245 CDD:409353 1/4 (25%)
Ig 1265..1344 CDD:472250
Ig strand B 1279..1283 CDD:409353
Ig strand C 1293..1297 CDD:409353
Ig strand E 1309..1313 CDD:409353
Ig strand F 1323..1331 CDD:409353
Ig strand G 1337..1340 CDD:409353
Ig <1365..1440 CDD:472250
Ig strand B 1365..1369 CDD:409267
Ig strand C 1378..1382 CDD:409267
Ig strand E 1409..1415 CDD:409267
Ig strand F 1425..1430 CDD:409267
Ig_3 1450..1517 CDD:464046
Ig strand B 1555..1558 CDD:409353
Ig <1556..1630 CDD:472250
Ig strand C 1566..1570 CDD:409353
Ig strand E 1599..1602 CDD:409353
Ig strand F 1614..1619 CDD:409353
Ig strand G 1627..1630 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.