DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and Nectin1

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001093946.1 Gene:Nectin1 / 192183 RGDID:620791 Length:515 Species:Rattus norvegicus


Alignment Length:439 Identity:92/439 - (20%)
Similarity:141/439 - (32%) Gaps:144/439 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FKPDGEILRVLVNSSAQ--------IKCDVGSSQADDKVLLVVWY------KNNLPIYSYDTRGA 78
            |.|......|.||.|..        :.|...:.....|:..|.|.      |.|:.||: .|.|.
  Rat    24 FLPGTHTQVVQVNDSMYGFIGTDVILHCSFANPLPTVKITQVTWQKASNGSKQNMAIYN-PTMGV 87

  Fly    79 HAGTPSHWRDEEVLEDRAVFRTHKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVP 143
            .. .|.:.:..|.|....:..|      :.::.::.:|.|.:.|......:..|.|.:||.|:..
  Rat    88 SV-LPPYEKRVEFLRPSFIDGT------IRLSHLELEDEGMYICEFATFPTGNRESQLNLTVMAK 145

  Fly   144 PTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINS 208
            ||..|...:..||  :|.|  ::...|..||....|.||..|.|                   .:
  Rat   146 PTNWIEGTQAVLR--ARKG--QDDKVLVATCTSANGKPPSVVSW-------------------ET 187

  Fly   209 KLVVRNLSRIHQHAVYTCQASNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAI 273
            :|                                                      |.|.|.|.|
  Rat   188 RL------------------------------------------------------KGEAEYQEI 198

  Fly   274 GSRPPAKITWWMGNLELHGHSQKVSEDGNVSTSVLS---ITPTREDHGKALSCRATNELVRNGIR 335
              |.|                       |.:.:|:|   :.|:||.|.::|:|.....|.|  .|
  Rat   199 --RNP-----------------------NGTVTVISRYRLVPSREAHRQSLACIVNYHLDR--FR 236

  Fly   336 ETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGV 400
            | ::.|||.:.|.:.::   ..:.....:..||...||..|||.|.:..|    ..:..:...||
  Rat   237 E-SLTLNVQYEPEVTIE---GFDGNWYLQRTDVKLTCKADANPPATEYHW----TTLNGSLPKGV 293

  Fly   401 IVSSGDLALQGVTRHQ-AGNYTCTASNV----EGDGDSNVVELKVMYKP 444
            ...:..|..:|...:. ||.|.|.|:|.    .|..:.|:.|..  |.|
  Rat   294 EAQNRTLFFRGPINYSLAGTYICEATNPIGTRSGQVEVNITEFP--YTP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 25/118 (21%)
Ig_3 165..230 CDD:464046 9/64 (14%)
Ig 262..343 CDD:472250 21/83 (25%)
Ig strand B 266..270 CDD:409416 1/3 (33%)
Ig strand C 280..284 CDD:409416 0/3 (0%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 18/68 (26%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
Nectin1NP_001093946.1 IgV_1_Nectin-1_like 31..143 CDD:409469 25/119 (21%)
FR1 31..54 CDD:409469 5/22 (23%)
Ig strand A 31..35 CDD:409469 1/3 (33%)
Ig strand A' 37..41 CDD:409469 1/3 (33%)
Ig strand B 46..54 CDD:409469 1/7 (14%)
CDR1 55..62 CDD:409469 0/6 (0%)
FR2 63..69 CDD:409469 2/5 (40%)
Ig strand C 64..69 CDD:409469 2/4 (50%)
CDR2 70..89 CDD:409469 6/19 (32%)
Ig strand C' 79..84 CDD:409469 2/5 (40%)
Ig strand C' 86..90 CDD:409469 1/4 (25%)
FR3 90..128 CDD:409469 7/43 (16%)
Ig strand D 97..101 CDD:409469 1/3 (33%)
Ig strand E 106..113 CDD:409469 1/12 (8%)
Ig strand F 120..128 CDD:409469 2/7 (29%)
CDR3 129..132 CDD:409469 0/2 (0%)
Ig strand G 132..142 CDD:409469 4/9 (44%)
FR4 133..143 CDD:409469 4/9 (44%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 37/201 (18%)
Ig strand A 146..152 CDD:143298 3/5 (60%)
Ig strand B 168..175 CDD:143298 3/6 (50%)
Ig strand C 180..186 CDD:143298 3/24 (13%)
Ig strand C' 188..190 CDD:143298 1/55 (2%)
Ig strand D 191..199 CDD:143298 4/9 (44%)
Ig strand E 205..213 CDD:143298 2/7 (29%)
Ig strand F 223..230 CDD:143298 2/6 (33%)
Ig strand G 234..240 CDD:143298 3/8 (38%)
Ig 247..333 CDD:472250 21/92 (23%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/7 (14%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 330..333 CDD:409353 0/2 (0%)
TM_EGFR-like 353..382 CDD:213052
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.