DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and Icam2

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_011247063.1 Gene:Icam2 / 15896 MGIID:96394 Length:313 Species:Mus musculus


Alignment Length:226 Identity:43/226 - (19%)
Similarity:81/226 - (35%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VVPPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGA 205
            |..|..|.|         .:..|....||.|....||        ||     .:..:|:.|....
Mouse    37 VCEPAAPFI---------CKVLPQRMKGSGEKAFEVY--------IW-----SEKQIVEATESWK 79

  Fly   206 IN-----------------SKLVVRN----------LSRIHQHAVYTCQASNFHKKYVATNITID 243
            ||                 :|:::..          :|.:.:..|:.|..:...|:: :.::.|.
Mouse    80 INCSTNCAAPDMGGLETPTNKIMLEEHPQGKWKQFLVSNVSKDTVFFCHFTCSGKQH-SESLNIR 143

  Fly   244 LYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWM--GNLEL----HGHSQKVSEDGN 302
            :|..|..|.:......:.....:.|||.....:|..::|..:  |...|    .|.::.|.::  
Mouse   144 VYQPPAQVTLKLQPPRVFVGEDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGGAETVPQE-- 206

  Fly   303 VSTSVLSITPTREDHGKALSCRATNELVRNG 333
             :|:..:.|..::| |...||:|..:|..:|
Mouse   207 -ATATFNSTALKKD-GLNFSCQAELDLRPHG 235

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 15/91 (16%)
Ig 262..343 CDD:472250 18/78 (23%)
Ig strand B 266..270 CDD:409416 1/3 (33%)
Ig strand C 280..284 CDD:409416 1/3 (33%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416
Ig_3 358..426 CDD:464046
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
Icam2XP_011247063.1 IgI_N_ICAM-2 61..145 CDD:409587 14/97 (14%)
Ig strand A 63..66 CDD:409587 2/10 (20%)
Ig strand A' 69..72 CDD:409587 0/2 (0%)
Ig strand B 77..83 CDD:409587 2/5 (40%)
Ig strand C 90..95 CDD:409587 0/4 (0%)