DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and CEACAM5

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_004354.3 Gene:CEACAM5 / 1048 HGNCID:1817 Length:702 Species:Homo sapiens


Alignment Length:602 Identity:133/602 - (22%)
Similarity:216/602 - (35%) Gaps:141/602 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSRAGP----YEEGGSLEV 172
            |...|..:::|.....:|..|:.:|.|.|:..|..|.|            .|    |..|.:|.:
Human   205 VTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTI------------SPLNTSYRSGENLNL 257

  Fly   173 TCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNFHKKYVA 237
            :|.. ..:||....|.:||..|.|          ..:|.:.|:: ::....|||||.|.......
Human   258 SCHA-ASNPPAQYSWFVNGTFQQS----------TQELFIPNIT-VNNSGSYTCQAHNSDTGLNR 310

  Fly   238 TNI-TIDLYLRPLLVEISFNN-QPMSADRKYEIECQAIGSRPPAKIT---WWMGNLELHGHSQKV 297
            |.: ||.:|..|....|:.|| .|:..:....:.|:     |..:.|   ||:.|..|....:..
Human   311 TTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCE-----PEIQNTTYLWWVNNQSLPVSPRLQ 370

  Fly   298 SEDGNVSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPED- 361
            ..:.|.:.::||:  ||.|.| ...|...|||..:  ....:.|||.:            .|:| 
Human   371 LSNDNRTLTLLSV--TRNDVG-PYECGIQNELSVD--HSDPVILNVLY------------GPDDP 418

  Fly   362 --------IEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAG 418
                    ...|.::...|...:||.| :..|..:..|.||.|         :|.:..:|...:|
Human   419 TISPSYTYYRPGVNLSLSCHAASNPPA-QYSWLIDGNIQQHTQ---------ELFISNITEKNSG 473

  Fly   419 NYTCTASN-VEGDGDSNVVELKV---MYKPICRPDQKKIYGVARNEAAEIVCEVDAFPPPEN--F 477
            .|||.|:| ..|...:.|..:.|   :.||....:..|  .|...:|....||    |..:|  :
Human   474 LYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSK--PVEDKDAVAFTCE----PEAQNTTY 532

  Fly   478 KWSFNNTAETFDMPQSGFRPHSAQGSTLTYTPVKEMDFGTIMCWADNNV-GQQKEPCVFHLIAAG 541
            .|..|..:    :|.|.....|....|||...|...|....:|...|:| ..:.:|....::.. 
Human   533 LWWVNGQS----LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYG- 592

  Fly   542 KPEAPTNCTVVNQTSDS------LEVYCIEGFDGGMR-QWFLMEIFDQHS-----GQLQANISAK 594
             |:.|    :::....|      |.:.|....:...: .|.:..|..||:     .::..|.:..
Human   593 -PDTP----IISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGT 652

  Fly   595 FAALSVTGLDAGRLFRIYVYAVNGRGRSDAIALDGYTLKAAEKQTVALTSYKGSAQSPDNFELTP 659
            :|.. |:.|..||                            ....|...:...|..||.   |:.
Human   653 YACF-VSNLATGR----------------------------NNSIVKSITVSASGTSPG---LSA 685

  Fly   660 ILSIGIFVGILVAIVCI 676
            ..::||.:|:||.:..|
Human   686 GATVGIMIGVLVGVALI 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653 7/27 (26%)
Ig_3 165..230 CDD:464046 17/64 (27%)
Ig 262..343 CDD:472250 19/83 (23%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 1/6 (17%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 0/2 (0%)
Ig_3 358..426 CDD:464046 19/76 (25%)
Ig_3 456..524 CDD:464046 17/69 (25%)
FN3 545..622 CDD:473895 14/88 (16%)
CEACAM5NP_004354.3 IgV_CEACAM_D1 36..140 CDD:409430
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430
Ig strand C' 78..83 CDD:409430
Ig strand C' 88..91 CDD:409430
FR3 98..124 CDD:409430
Ig strand D 98..103 CDD:409430
Ig strand E 105..109 CDD:409430
Ig strand F 119..124 CDD:409430
CDR3 125..132 CDD:409430
FR4 133..140 CDD:409430
Ig strand G 133..139 CDD:409430
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 7/28 (25%)
Ig strand A 146..150 CDD:409402
Ig strand A' 153..158 CDD:409402
Ig strand B 163..169 CDD:409402
Ig strand C 176..181 CDD:409402
Ig strand C' 183..186 CDD:409402
Ig strand D 190..194 CDD:409402
Ig strand E 197..202 CDD:409402
Ig strand F 212..220 CDD:409402 1/7 (14%)
Ig strand G 224..233 CDD:409402 3/8 (38%)
IgC2_CEACAM5-like 243..318 CDD:409540 23/86 (27%)
Ig strand A 243..249 CDD:409540 1/5 (20%)
Ig strand B 254..261 CDD:409540 2/6 (33%)
Ig strand C 267..273 CDD:409540 1/5 (20%)
Ig strand C' 276..281 CDD:409540 2/14 (14%)
Ig strand E 284..290 CDD:409540 2/5 (40%)
Ig strand F 293..304 CDD:409540 5/10 (50%)
Ig strand G 307..318 CDD:409540 3/10 (30%)
IgI_hCEACAM_2_4_6_like 324..412 CDD:409402 24/97 (25%)
Ig strand A 324..328 CDD:409402 0/3 (0%)
Ig strand A' 331..336 CDD:409402 2/4 (50%)
Ig strand B 341..347 CDD:409402 1/10 (10%)
Ig strand C 354..359 CDD:409402 2/4 (50%)
Ig strand C' 361..364 CDD:409402 0/2 (0%)
Ig strand D 368..372 CDD:409402 0/3 (0%)
Ig strand E 375..380 CDD:409402 1/4 (25%)
Ig strand F 390..398 CDD:409402 1/7 (14%)
Ig strand G 402..411 CDD:409402 1/10 (10%)
IgC2_CEACAM5-like 421..496 CDD:409540 20/84 (24%)
Ig strand A 421..427 CDD:409540 0/5 (0%)
Ig strand B 432..439 CDD:409540 1/6 (17%)
Ig strand C 445..451 CDD:409540 2/6 (33%)
Ig strand C' 454..459 CDD:409540 2/4 (50%)
Ig strand E 462..468 CDD:409540 1/5 (20%)
Ig strand F 471..482 CDD:409540 5/10 (50%)
Ig strand G 485..496 CDD:409540 2/10 (20%)
IgI_hCEACAM_2_4_6_like 502..590 CDD:409402 23/97 (24%)
Ig strand A 502..506 CDD:409402 2/3 (67%)
Ig strand A' 509..514 CDD:409402 1/6 (17%)
Ig strand B 519..525 CDD:409402 2/9 (22%)
Ig strand C 532..537 CDD:409402 1/4 (25%)
Ig strand C' 539..542 CDD:409402 0/6 (0%)
Ig strand D 546..550 CDD:409402 0/3 (0%)
Ig strand E 553..558 CDD:409402 2/4 (50%)
Ig strand F 568..576 CDD:409402 1/7 (14%)
Ig strand G 580..589 CDD:409402 1/8 (13%)
IgC2_CEACAM5-like 599..674 CDD:409540 14/103 (14%)
Ig strand A 599..605 CDD:409540 0/5 (0%)
Ig strand B 610..617 CDD:409540 2/6 (33%)
Ig strand C 623..629 CDD:409540 1/5 (20%)
Ig strand C' 632..637 CDD:409540 2/4 (50%)
Ig strand E 640..646 CDD:409540 0/5 (0%)
Ig strand F 649..660 CDD:409540 2/11 (18%)
Ig strand G 663..674 CDD:409540 3/38 (8%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.