DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VI and icam3

DIOPT Version :10

Sequence 1:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_002661307.2 Gene:icam3 / 100334824 ZFINID:ZDB-GENE-060503-219 Length:551 Species:Danio rerio


Alignment Length:365 Identity:73/365 - (20%)
Similarity:131/365 - (35%) Gaps:75/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDG-----------AINSKLVVRNLSRIHQH 221
            |:||....:   ||...|:...:....|.....|:||           ...:.|:...:|::...
Zfish    30 GALECPLQI---SPQSVVVRYGDSVSVNCSTSVTHDGMGWESTKGGVPLSKASLITWRVSQLTDW 91

  Fly   222 AVYT--CQASNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKIT-- 282
            .:..  |..:...::.....:.:.:|..|..|.||..||.|:...:||::|......|...:|  
Zfish    92 EIEPPFCYINYGQQQQCEVALPVTIYKTPDSVSISTANQAMTEGNQYELQCDIHNVAPAQNLTVN 156

  Fly   283 WWMGNLELHGHSQKVSEDGNVSTSV-----LSITPTREDHGKALSCRATNELVRNGIRETAMKLN 342
            |:.|...::    :.:...|..:.|     |.|.|.|.|.|....|.|                 
Zfish   157 WYKGETLVN----QTNFTDNTKSPVNKIIRLPIHPDRADDGAQYRCEA----------------- 200

  Fly   343 VFFIPTLQLDLGS---NLNPEDIEE--GDDVYFECKVHANPAAYKVVWKHNHQII---QHNQRAG 399
                   :|:||.   ..:|::..|  ...|:|:..:|..|:...||..::..::   :.:.:..
Zfish   201 -------ELNLGEEGPQPHPKNTSEPLSITVHFKPTIHKLPSTVSVVRGYSKVVVCKSEGHPKPT 258

  Fly   400 VIVSSGDLALQG----VTRHQAGNYTCTASNVEGDGDSNVVELKVMYKPICRPDQKKIYGVARNE 460
            :..|.|...:.|    :|...|.|.||||:|..|....:|.   |:.:.........|..:....
Zfish   259 ISWSDGTNTVNGENFTITESTAENLTCTATNAVGSSSRSVT---VVIQDFSISAVNYIEPMIEGN 320

  Fly   461 AAEIVCEVDAFPPPENF--KW-------SFNNTAETFDMP 491
            ..|:.|:|...|..::.  .|       :..|...||:.|
Zfish   321 QYELQCDVYNVPAAQSLTVNWYKGETLVTQTNFTNTFESP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 165..230 CDD:464046 13/74 (18%)
Ig 262..343 CDD:472250 17/87 (20%)
Ig strand B 266..270 CDD:409416 2/3 (67%)
Ig strand C 280..284 CDD:409416 1/5 (20%)
Ig strand F 320..325 CDD:409416 1/4 (25%)
Ig strand G 336..339 CDD:409416 0/2 (0%)
Ig_3 358..426 CDD:464046 18/76 (24%)
Ig_3 456..524 CDD:464046 9/45 (20%)
FN3 545..622 CDD:473895
icam3XP_002661307.2 Ig 38..117 CDD:472250 10/81 (12%)
Ig strand B 51..55 CDD:409353 0/3 (0%)
Ig strand C 63..67 CDD:409353 1/3 (33%)
Ig strand E 84..88 CDD:409353 1/3 (33%)
Ig strand F 95..100 CDD:409353 1/4 (25%)
Ig strand G 108..111 CDD:409353 0/2 (0%)
Ig 119..219 CDD:472250 28/127 (22%)
Ig strand B 138..142 CDD:409353 2/3 (67%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 1/3 (33%)
Ig strand F 195..200 CDD:409353 1/4 (25%)
Ig strand G 216..219 CDD:409353 0/2 (0%)
Ig 239..302 CDD:472250 16/65 (25%)
Ig strand B 245..249 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand F 282..287 CDD:409353 3/4 (75%)
Ig strand G 295..298 CDD:409353 0/2 (0%)
Ig_3 400..464 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.