Sequence 1: | NP_001036705.1 | Gene: | side-VI / 4379854 | FlyBaseID: | FBgn0083950 | Length: | 1087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001920347.3 | Gene: | si:ch211-66e2.5 / 100150500 | ZFINID: | ZDB-GENE-131121-180 | Length: | 302 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 48/202 - (23%) |
---|---|---|---|
Similarity: | 84/202 - (41%) | Gaps: | 26/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 ITIDLYLRPLLVEISFNN--QPMSADRKYEIECQAIGSRPPAKIT--WWMGNLELHGHS-QKVSE 299
Fly 300 DGNVS-TSVLSITPTREDHGKALSCRATNELVRNG------IRETAMKLNVFFIPTLQLDLGSNL 357
Fly 358 NPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTC 422
Fly 423 TASNVEG 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
side-VI | NP_001036705.1 | IG_like | 35..140 | CDD:214653 | |
Ig_3 | 157..230 | CDD:290638 | |||
IG_like | 165..242 | CDD:214653 | 0/1 (0%) | ||
Ig | 265..343 | CDD:299845 | 18/87 (21%) | ||
IG_like | 267..343 | CDD:214653 | 17/85 (20%) | ||
IG_like | 363..440 | CDD:214653 | 18/67 (27%) | ||
IGc2 | 364..429 | CDD:197706 | 17/64 (27%) | ||
IG_like | 456..532 | CDD:214653 | |||
Ig_3 | 456..524 | CDD:290638 | |||
fn3 | 545..622 | CDD:278470 | |||
si:ch211-66e2.5 | XP_001920347.3 | Ig | 108..203 | CDD:299845 | 25/94 (27%) |
IG_like | 122..196 | CDD:214653 | 17/73 (23%) | ||
IG_like | 227..293 | CDD:214653 | 19/75 (25%) | ||
Ig_2 | 227..284 | CDD:290606 | 16/70 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |