DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34117 and Fmc1

DIOPT Version :9

Sequence 1:NP_001036690.1 Gene:CG34117 / 4379851 FlyBaseID:FBgn0083953 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_079639.1 Gene:Fmc1 / 66117 MGIID:1913367 Length:113 Species:Mus musculus


Alignment Length:98 Identity:39/98 - (39%)
Similarity:63/98 - (64%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVLRSLLHELR--QASPNGCIKDSLAARYILAQYKKFATTEQQFCKARNEATFLGQTYLTYLASQ 67
            :.||.||.|||  .|:.....:|:.|.||::..::....|.::.|:|::|..|...|||..|:|.
Mouse     9 RTLRGLLRELRYLNAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLSSI 73

  Fly    68 RRYLELYKEYHGRGERSVRDTADLVGFKLPSDP 100
            |:::.|::|:||:|||||.::|.|||.:||..|
Mouse    74 RQHVALHQEFHGKGERSVEESAGLVGLQLPRQP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34117NP_001036690.1 Complex1_LYR_2 8..95 CDD:289975 35/88 (40%)
Fmc1NP_079639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..113 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845954
Domainoid 1 1.000 72 1.000 Domainoid score I9368
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008307
OrthoInspector 1 1.000 - - oto92122
orthoMCL 1 0.900 - - OOG6_110928
Panther 1 1.100 - - LDO PTHR31716
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2872
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.