DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34117 and C29E4.12

DIOPT Version :9

Sequence 1:NP_001036690.1 Gene:CG34117 / 4379851 FlyBaseID:FBgn0083953 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_741234.1 Gene:C29E4.12 / 259333 WormBaseID:WBGene00016209 Length:108 Species:Caenorhabditis elegans


Alignment Length:99 Identity:33/99 - (33%)
Similarity:56/99 - (56%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRSLLHELRQA----SPNGCIKDSLAARYILAQYKKFATTEQQFCKARNEATFLGQTYLTYLASQ 67
            :::::.||::.    |||     |...:|::.|.|....|.:::.||.||:..:.:.||:|:...
 Worm    15 IKNIISELKKVDKTFSPN-----SAQYKYLMEQMKADQVTTRRYSKAENESESVAKLYLSYIKGT 74

  Fly    68 RRYLELYKEYHGRGERSVRDTADLVGFKLPSDPK 101
            |:..||.:.|.| ||:||.:.|.:||.|||...|
 Worm    75 RQLNELQERYKG-GEKSVEEAAAIVGLKLPEQKK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34117NP_001036690.1 Complex1_LYR_2 8..95 CDD:289975 29/90 (32%)
C29E4.12NP_741234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164078
Domainoid 1 1.000 49 1.000 Domainoid score I7982
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4044
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008307
OrthoInspector 1 1.000 - - oto20828
orthoMCL 1 0.900 - - OOG6_110928
Panther 1 1.100 - - LDO PTHR31716
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2872
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.